Citrus Sinensis ID: 019157

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-----

MINSLRSKKFNVIAVDLPGNGFSDRSRMEFEERSDGAFQRFKDVYGLIQEKGFFWAFDQIVETGQIPYEEILKARVLERKSVKVIELGSDEVGRVLGQVIDTFNLAPVHLVLHDSALPMSANWVAENPGSVKSLTLLDTGIKPALPLFALNLPLIRDFVLGSSFGYQWLIRFCCMKKVGSFDVEDNRVLLKGRDRCRAVSEMGRKLNNSFDMAEWGSSEGIKGIPMQILWSSVWSKEWSEEGSRVADALPQAKFVGHSGGRWPQVDSADELAKHIADFVSSLPKTVRQVEEEPIPEHIQKMFDEASSSGHNHDHHHSHSGHDNHEGHAHAAGYMDAYGLGHTWGQ

ccccccccccEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHcHHHHHHHHHHcccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHccccccEEEEEcccccccccHHHHcccccHHHHHccHHHHHHHHHHHcccccccccHHHHHHHHHcccHHHHHHHHHHHcccccccHHcccccccccccEEEEEccccccccHHHHHHHHHHccccCEEccccccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccHcccccccccc

********KFNVIAVDLPGNG*************DGAFQRFKDVYGLIQEKGFFWAFDQIVETGQIPYEEILKARVLERKSVKVIELGSDEVGRVLGQVIDTFNLAPVHLVLHDSALPMSANWVAENPGSVKSLTLLDTGIKPALPLFALNLPLIRDFVLGSSFGYQWLIRFCCMKKVGSFDVEDNRVLLKGRDRCRAVSEMGRKLNNSFDMAEWGSSEGIKGIPMQILWSSVWSKEWSEEGSRVADALPQAKFVGHSGGRWPQVDSADELAKHIADFVS*********************************************GHAHAAGYMDAYGLGHT***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein AUXIN RESPONSE 4	Required for the auxin influx facilitator AUX1 polar trafficking and its asymmetric localization within the plasma membrane. Not involved in the PIN proteins localization.	probable	Q9FZ33

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QVB, chain A
Confidence level:confident
Coverage over the Query: 1-30,84-282
View the alignment between query and template
View the model in PyMOL

Template: 2BKL, chain A
Confidence level:confident
Coverage over the Query: 90-180,198-284
View the alignment between query and template
View the model in PyMOL