Citrus Sinensis ID: 019200

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340----

MAEEKHQVPRVKLGTQGLEVSKLGYGCMNLSGGYSSPVSEEDGISMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPREKIQVATKFGIAGIGVAGVIVKGAPDYVRSCCEASLKRLDVDYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPGTIRRAHAVHPITAVQMEWSLWTRDIEEEIIPLCRELGIGIVPYSPLGRGFFGGKAVVENVPADSFLHFLPRFKGENLDRNKSIYFRIGNLAKKYNCTSAQLALAWVLGQGDDVVPIPGTTKMKNLDDNIDSLRIKLTKEDLKEISDAVPIEEVAGNRDPEGFDKASWKFANTPPKDC

cccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHcccccccEEEEEEcccEEcccccccccccHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHccccccHHHHHHHcccccHHHHHHHHHHHHccEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccEEEcccccccccHHHHHccccccccHHHHHHHHHHccccccccccccHHHHHHHccccccccccc

************LGTQGLEVSKLGYGCMNLSGGYSSPVSEEDGISMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPREKIQVATKFGIAGIGVAGVIVKGAPDYVRSCCEASLKRLDVDYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPGTIRRAHAVHPITAVQMEWSLWTRDIEEEIIPLCRELGIGIVPYSPLGRGFFGGKAVVENVPADSFLHFLPRFKGENLDRNKSIYFRIGNLAKKYNCTSAQLALAWVLGQGDDVVPIPGTTKMKNLDDNIDSLRIKLTKEDLKEISDAVPIEEVAGNRDPEGFDKASWKF*NTPP***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAEEKHQVPRVKLGTQGLEVSKLGYGCMNLSGGYSSPVSEEDGISMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPREKIQVATKFGIAGIGVAGVIVKGAPDYVRSCCEASLKRLDVDYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPGTIRRAHAVHPITAVQMEWSLWTRDIEEEIIPLCRELGIGIVPYSPLGRGFFGGKAVVENVPADSFLHFLPRFKGENLDRNKSIYFRIGNLAKKYNCTSAQLALAWVLGQGDDVVPIPGTTKxxxxxxxxxxxxxxxxxxxxxEISDAVPIEEVAGNRDPEGFDKASWKFANTPPKDC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable aldo-keto reductase 1	May interfere with the nodulation process and inhibits nodule development.	confident	C6TBN2
Perakine reductase	Aldo-keto reductase involved in the biosynthesis of monoterpenoid indole alkaloids. Broad substrate specificity enzyme with a high selectivity in the group of alkaloids. Can use perakine, 19(S),20(R)-dihydro-peraksine-17,21-al, cinnamic aldehyde, p-coumaric aldehyde and 3-(3,4,5-trimethoxyphenyl)propanal as substrates, but not ketosteroids such as progesterone. NADPH could not be replaced by NADH.	probable	Q3L181
Probable aldo-keto reductase 3		probable	O22707

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3V0S, chain A
Confidence level:very confident
Coverage over the Query: 8-225,251-316,334-342
View the alignment between query and template
View the model in PyMOL