Citrus Sinensis ID: 019201


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340----
MAASEEVNLNDSKMVVPLHTWVLISNFKLAYNLLRRPDGTFNRHLAEFLDRKVPANANPVDGVFSFDVIVDRGTNLLCRIYRPTNGEEHRPNIAELEKPVSSEVVVPVIIFFHGGSFAHSSANSAIYDILCRRLVGTCKAVVVSVNYRRAPENRYPCAYDDGWTVLKWAKSRSWLQSKDSKAHIYLAGDSSGGNIVHHVALRAVESEVEILGNILLNPMFGGQERTESEKRLDGKYFVTVQDRDWYWRAYLPEGANRDHPACNPFGPKGIDLVGVKFPKSLVVVAGLDLIQDWQLAYMEGLKKAGQDVKLLYLEQATIGFYFLPNNGHFYTVMDEISNFVSCNY
cccccccccccccccccccccEEHHHHHHHcccEEccccCEEEccccccccccccccccccccEEEEEEEcccccEEEEEEEcccccccccccccccccccccccccEEEEECcccEEEcccccccHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHHHHHccccccccccccEEEEccccHHHHHHHHHHHHccccccEEEEEEEccccccccccHHHHcccccccccHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEccccccHHHHHHHHHHHHHccccEEEEEEcccEEEEEEccccHHHHHHHHHHHHHHHccc
************KMVVPLHTWVLISNFKLAYNLLRRPDGTFNRHLAEFLDRKVPANANPVDGVFSFDVIVDRGTNLLCRIYRPTNGEEHRPN******PVSSEVVVPVIIFFHGGSFAHSSANSAIYDILCRRLVGTCKAVVVSVNYRRAPENRYPCAYDDGWTVLKWAKSRSWLQSKDSKAHIYLAGDSSGGNIVHHVALRAVESEVEILGNILLNPMFGGQERTESEKRLDGKYFVTVQDRDWYWRAYLPEGANRDHPACNPFGPKGIDLVGVKFPKSLVVVAGLDLIQDWQLAYMEGLKKAGQDVKLLYLEQATIGFYFLPNNGHFYTVMDEISNFVSCNY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAASEEVNLNDSKMVVPLHTWVLISNFKLAYNLLRRPDGTFNRHLAEFLDRKVPANANPVDGVFSFDVIVDRGTNLLCRIYRPTNGEEHRPNIAELEKPVSSEVVVPVIIFFHGGSFAHSSANSAIYDILCRRLVGTCKAVVVSVNYRRAPENRYPCAYDDGWTVLKWAKSRSWLQSKDSKAHIYLAGDSSGGNIVHHVALRAVESEVEILGNILLNPMFGGQERTESEKRLDGKYFVTVQDRDWYWRAYLPEGANRDHPACNPFGPKGIDLVGVKFPKSLVVVAGLDLIQDWQLAYMEGLKKAGQDVKLLYLEQATIGFYFLPNNGHFYTVMDEISNFVSCNY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Gibberellin receptor GID1C Functions as soluble gibberellin (GA) receptor. GA is an essential hormone that regulates growth and development in plants. Binds with high affinity the biologically active gibberellin GA4, but has no affinity for the biologically inactive GAs. In response to GA, interacts with specific DELLA proteins, known as repressors of GA-induced growth, and targets them for degradation via proteasome. Seems to be required for GA signaling that controls root growth, seed germination and stem elongation. Partially redundant with GID1A and GID1B.confidentQ940G6
Gibberellin receptor GID1 Functions as soluble gibberellin (GA) receptor. GA is an essential hormone that regulates growth and development in plants. Binds with high affinity the biologically active GAs such as GA1, GA3 and GA4, but has low or no affinity for the biologically inactive GAs. Upon GA-binding, it interacts with the DELLA protein SLR1, a repressor of GA signaling. This leads to SLR1 degradation by the proteasome, allowing the GA signaling pathway.probableQ6L545
Gibberellin receptor GID1A Functions as soluble gibberellin (GA) receptor. GA is an essential hormone that regulates growth and development in plants. Binds with high affinity the biologically active gibberellin GA4, but has no affinity for the biologically inactive GAs. In response to GA, interacts with specific DELLA proteins, known as repressors of GA-induced growth, and targets them for degradation via proteasome. Seems to be required for GA signaling that controls root growth, seed germination, stem elongation and flower development. Partially redundant with GID1B and GID1C.probableQ9MAA7

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZSH, chain A
Confidence level:very confident
Coverage over the Query: 6-342
View the alignment between query and template
View the model in PyMOL