Citrus Sinensis ID: 019209

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340----
MAKQEAAVPEREIFSLSGPLYLTAVDWKNPHHRRAVAASLVRGVYILERDHQENRLGHQAQASPWWNFFHFQLSRMLIDDVDYSVFGAIYEYHSFAFDCNAPKFVIAFRGTIKKPDTKSRDLKLDLQCISNRLHQSSRFQLSMQAIQNVISLVGAANIWLAGHSLGSAIALLAGKNMTRMGYPMETYLFNPPFPSVPIERINNEKVKHGIRAASSVVKAGFAVAKKGQNQRSQKDDSFYALSEWVPGLFVNPADHICSEYIGYFEHRKKMEKIGGSKIERLATQYSIGSMISGVFGGDSEALHLLPSANLTINLSHCPDFKRAHGIHQWWDPNFLGQSELHLFR
ccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEcccccccEEEEEEcccccccccccccEEEEEEccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHcccEEcccHHHHHHHHHHHHcccccccccHHHHcccccccEEEEcccccccccccccHHHHHHHHHHcccHHHHHHcccccccccccccccccccccccccEEEEEEccccccccccccccccccccccccccccccc
ccccEEEccccHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHcccEEEEEEEccccccEEEEEEEEcccccccccccEEEEEEccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHHHHccccEEEEEcccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHcHHHcccccHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHHHHHcccccHHHccccccHHHHHHHHcccccccccccccEEEEEEccccHHHHHHcccHHccccccHHHHHHHccc
makqeaavpereifslsgplyltavdwknphhrRAVAASLVRGVYILERdhqenrlghqaqaspwwnfFHFQLSRmliddvdySVFGAIYEyhsfafdcnapKFVIAFrgtikkpdtksrdlkLDLQCISNRLHQSSRFQLSMQAIQNVISLVGAANIWLAGHSLGSAIALLAGknmtrmgypmetylfnppfpsvpierinnekvKHGIRAASSVVKAGFAVakkgqnqrsqkddsfyalsewvpglfvnpadhicSEYIGYFEHRKKMEKIGGSKIERLATQYSIGSmisgvfggdsealhllpsanltinlshcpdfkrahgihqwwdpnflgqselhlfr
makqeaavpereifslsgpLYLTAVDWKNPHHRRAVAASLVRGVYILERDHQENRLGHQAQASPWWNFFHFQLSRMLIDDVDYSVFGAIYEYHSFAFDCNAPKFVIAFRGtikkpdtksrdLKLDLQCISNRLHQSSRFQLSMQAIQNVISLVGAANIWLAGHSLGSAIALLAGKNMTRMGYPMETYLFNPPFPSVPIERINNEKVKHGIRAASSVVKAGFAvakkgqnqrsqkdDSFYALSEWVPGLFVNPADHICSEYIGYFEHRKKMEKIGGSKIERLATQYSIGSMISGVFGGDSEALHLLPSANLTINLSHCPDFKRAHGIHQWWDPNFLGQSELHLFR
MAKQEAAVPEREIFSLSGPLYLTAVDWKNPHHRRAVAASLVRGVYILERDHQENRLGHQAQASPWWNFFHFQLSRMLIDDVDYSVFGAIYEYHSFAFDCNAPKFVIAFRGTIKKPDTKSRDLKLDLQCISNRLHQSSRFQLSMQAIQNVISLVGAANIWLAGHSLGSAIALLAGKNMTRMGYPMETYLFNPPFPSVPIERINNEKVKHGIRAASSVVKAGFAVAKKGQNQRSQKDDSFYALSEWVPGLFVNPADHICSEYIGYFEHRKKMEKIGGSKIERLATQYSIGSMISGVFGGDSEALHLLPSANLTINLSHCPDFKRAHGIHQWWDPNFLGQSELHLFR
************IFSLSGPLYLTAVDWKNPHHRRAVAASLVRGVYILERDHQENRLGHQAQASPWWNFFHFQLSRMLIDDVDYSVFGAIYEYHSFAFDCNAPKFVIAFRGTIKKPDTKSRDLKLDLQCISNRLHQSSRFQLSMQAIQNVISLVGAANIWLAGHSLGSAIALLAGKNMTRMGYPMETYLFNPPFPSVPIERINNEKVKHGIRAASSVVKAGFAV*************SFYALSEWVPGLFVNPADHICSEYIGYFEHRKKMEKIGGSKIERLATQYSIGSMISGVFGGDSEALHLLPSANLTINLSHCPDFKRAHGIHQWWDPNFLGQ*******
**************SLSGPLYLTAVDWKNPHHRRAVAASLVRGVYILERDHQENRLGHQAQASPWWNFFHFQLSRMLIDDVDYSVFGAIYEYHSFAFDCNAPKFVIAFRGTIKKPDTKSRDLKLDLQCISNRLHQSSRFQLSMQAIQNVISLVGAANIWLAGHSLGSAIALLAGKNMTRMGYPMETYLFNPPFPSVPIERINNEKVKHGIRAASSVVKA**********************SEWVPGLFVNPADHICSEYIGYFEHRKK*********************************HLLPSANLTINLSHC*****AHGIHQWWDPNFLGQ*******
**********REIFSLSGPLYLTAVDWKNPHHRRAVAASLVRGVYILERDHQENRLGHQAQASPWWNFFHFQLSRMLIDDVDYSVFGAIYEYHSFAFDCNAPKFVIAFRGTIKKPDTKSRDLKLDLQCISNRLHQSSRFQLSMQAIQNVISLVGAANIWLAGHSLGSAIALLAGKNMTRMGYPMETYLFNPPFPSVPIERINNEKVKHGIRAASSVVKAGFAV************DSFYALSEWVPGLFVNPADHICSEYIGYFEHRKKMEKIGGSKIERLATQYSIGSMISGVFGGDSEALHLLPSANLTINLSHCPDFKRAHGIHQWWDPNFLGQSELHLFR
********PEREIFSLSGPLYLTAVDWKNPHHRRAVAASLVRGVYILERDHQENRLGHQAQASPWWNFFHFQLSRMLIDDVDYSVFGAIYEYHSFAFDCNAPKFVIAFRGTIKKPDTKSRDLKLDLQCISNRLHQSSRFQLSMQAIQNVISLVGAANIWLAGHSLGSAIALLAGKNMTRMGYPMETYLFNPPFPSVPIERINNEKVKHGIRAASSVVKAGFAVAKKGQNQRSQKDDSFYALSEWVPGLFVNPADHICSEYIGYFEHRKKMEKIGGSKIERLATQYSIGSMISGVFGGDSEALHLLPSANLTINLSHCPDFKRAHGIHQWWDPNFLGQSELHL**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKQEAAVPEREIFSLSGPLYLTAVDWKNPHHRRAVAASLVRGVYILERDHQENRLGHQAQASPWWNFFHFQLSRMLIDDVDYSVFGAIYEYHSFAFDCNAPKFVIAFRGTIKKPDTKSRDLKLDLQCISNRLHQSSRFQLSMQAIQNVISLVGAANIWLAGHSLGSAIALLAGKNMTRMGYPMETYLFNPPFPSVPIERINNEKVKHGIRAASSVVKAGFAVAKKGQNQRSQKDDSFYALSEWVPGLFVNPADHICSEYIGYFEHRKKMEKIGGSKIERLATQYSIGSMISGVFGGDSEALHLLPSANLTINLSHCPDFKRAHGIHQWWDPNFLGQSELHLFR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query344 2.2.26 [Sep-21-2011]
Q680C0350 GDSL esterase/lipase At4g no no 0.918 0.902 0.521 1e-102
>sp|Q680C0|GDL62_ARATH GDSL esterase/lipase At4g10955 OS=Arabidopsis thaliana GN=At4g10955 PE=2 SV=1 Back     alignment and function desciption
 Score =  372 bits (954), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 178/341 (52%), Positives = 242/341 (70%), Gaps = 25/341 (7%)

Query: 8   VPEREIFSLSGPLYLTAVDWKNPHHRRAVAASLVRGVYILERDHQENRLGHQAQASPWWN 67
           + ER+ FSL+GPL+LT++DW N HHRR+VA SLV+G+Y+ ERD Q  R G +   SP W+
Sbjct: 3   ISERDDFSLTGPLHLTSIDWANEHHRRSVAGSLVQGIYVAERDRQLQREGPELALSPIWS 62

Query: 68  -FFHFQLSRMLIDDVDYSVFGAIYEYH----------SFAFDCNAPKFVIAFRGTIKKPD 116
            FFHF+L R  +DD D S+FG IYEY           S  F   +P+FVIAFRGT+ K D
Sbjct: 63  EFFHFRLIRKFVDDADNSIFGGIYEYKLPQQLSQTVKSMEF---SPRFVIAFRGTVTKVD 119

Query: 117 TKSRDLKLDLQCISNRLHQSSRFQLSMQAIQNVISLVGAANIWLAGHSLGSAIALLAGKN 176
           + SRD++ D+  I N LH ++RF++++QA++N+++ VG +++WLAGHSLG+++ALL GK 
Sbjct: 120 SISRDIEHDIHVIRNGLHTTTRFEIAIQAVRNIVASVGGSSVWLAGHSLGASMALLTGKT 179

Query: 177 MTRMGYPMETYLFNPPFPSVPIERINNEKVKHGIRAASSVVKAGFAVAKKGQNQRSQKD- 235
           + R G+  E + FNPPF S PIE+I ++++KHGIR A SV+ AG A+AKK     SQ D 
Sbjct: 180 IARTGFFPECFAFNPPFLSAPIEKIKDKRIKHGIRIAGSVITAGLALAKKATQHYSQNDR 239

Query: 236 ------DSFYALSEWVPGLFVNPADHICSEYIGYFEHRKKMEKIGGSKIERLATQYSIGS 289
                 D F ALS+W P L+VNP DH+CSEY+GYFEHR KME+IG   +ER+ATQ+S+G 
Sbjct: 240 ALPAPPDPFEALSDWFPRLYVNPGDHLCSEYVGYFEHRNKMEEIGIGFVERVATQHSLGG 299

Query: 290 MISGVFGGDSEALHLLPSANLTINLSHCPDFKRAHGIHQWW 330
           M+     G  E +HL+PS+ LT+NLS   DFK+AHGIHQWW
Sbjct: 300 MLL----GGQEPVHLIPSSVLTVNLSSSRDFKQAHGIHQWW 336

Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: -

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query344
324329845342 triacylglycerol lipase 3 [Arachis hypoga 0.970 0.976 0.589 1e-117
224072212364 predicted protein [Populus trichocarpa] 0.973 0.920 0.597 1e-117
224058229343 predicted protein [Populus trichocarpa] 0.973 0.976 0.591 1e-116
255537815357 triacylglycerol lipase, putative [Ricinu 0.968 0.932 0.583 1e-114
356523549343 PREDICTED: GDSL esterase/lipase At4g1095 0.973 0.976 0.570 1e-114
356495719384 PREDICTED: GDSL esterase/lipase At4g1095 0.970 0.869 0.576 1e-114
356513277343 PREDICTED: GDSL esterase/lipase At4g1095 0.973 0.976 0.567 1e-113
225426308344 PREDICTED: GDSL esterase/lipase At4g1095 0.970 0.970 0.611 1e-111
449452218346 PREDICTED: GDSL esterase/lipase At4g1095 0.970 0.965 0.555 1e-110
388512187344 unknown [Medicago truncatula] 0.973 0.973 0.568 1e-109
>gi|324329845|gb|ADY38375.1| triacylglycerol lipase 3 [Arachis hypogaea] Back     alignment and taxonomy information
 Score =  428 bits (1101), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 200/339 (58%), Positives = 260/339 (76%), Gaps = 5/339 (1%)

Query: 10  EREIFSLSGPLYLTAVDWKNPHHRRAVAASLVRGVYILERDHQENRLGHQAQASPWWNFF 69
           ERE F LSGPLYLT VDW NP+HR++VAASLV+GVY+LE+D Q+ R G  A ASPWW FF
Sbjct: 4   ERESFDLSGPLYLTHVDWDNPNHRKSVAASLVQGVYVLEKDRQDRREGTDALASPWWVFF 63

Query: 70  HFQLSRMLIDDVDYSVFGAIYEYHSFAFDCN-----APKFVIAFRGTIKKPDTKSRDLKL 124
           +FQL   L+DDVD S+FGAIYE+   +  CN     +P +VIAFRGTI K D+ SRD++L
Sbjct: 64  NFQLLHKLVDDVDSSIFGAIYEFKPPSTYCNVTLHRSPHYVIAFRGTITKADSVSRDIEL 123

Query: 125 DLQCISNRLHQSSRFQLSMQAIQNVISLVGAANIWLAGHSLGSAIALLAGKNMTRMGYPM 184
           D+  + N LHQ+SR+++++QA++N+I+ VG + IWLAGHSLGSA++LL GK M + G  +
Sbjct: 124 DMHFVRNGLHQTSRYEIAIQAVRNMIATVGDSGIWLAGHSLGSAVSLLCGKTMAKSGNFI 183

Query: 185 ETYLFNPPFPSVPIERINNEKVKHGIRAASSVVKAGFAVAKKGQNQRSQKDDSFYALSEW 244
           E++LFNPP+ S PIERI ++KVKHG+R A SV+ AG  +A K + ++S   D F A S W
Sbjct: 184 ESFLFNPPYVSAPIERIKDKKVKHGLRIAGSVITAGLTLAVKAKQKKSLSSDPFAAFSAW 243

Query: 245 VPGLFVNPADHICSEYIGYFEHRKKMEKIGGSKIERLATQYSIGSMISGVFGGDSEALHL 304
           VP LFVNP+DHICSEYIGYFEHRKKME+IG   IERLATQ S+G ++ G FG +SE LHL
Sbjct: 244 VPCLFVNPSDHICSEYIGYFEHRKKMEEIGAGSIERLATQNSLGCLLMGAFGKESEPLHL 303

Query: 305 LPSANLTINLSHCPDFKRAHGIHQWWDPNFLGQSELHLF 343
           +PSA++T+NL+   DFK AHGIHQWW P+   QS+L+ +
Sbjct: 304 IPSASVTVNLTPSRDFKDAHGIHQWWKPHLHLQSKLYKY 342

Source: Arachis hypogaea

Species: Arachis hypogaea

Genus: Arachis

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224072212|ref|XP_002303655.1| predicted protein [Populus trichocarpa] gi|222841087|gb|EEE78634.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224058229|ref|XP_002299467.1| predicted protein [Populus trichocarpa] gi|222846725|gb|EEE84272.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255537815|ref|XP_002509974.1| triacylglycerol lipase, putative [Ricinus communis] gi|223549873|gb|EEF51361.1| triacylglycerol lipase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356523549|ref|XP_003530400.1| PREDICTED: GDSL esterase/lipase At4g10955-like [Glycine max] Back     alignment and taxonomy information
>gi|356495719|ref|XP_003516721.1| PREDICTED: GDSL esterase/lipase At4g10955-like [Glycine max] Back     alignment and taxonomy information
>gi|356513277|ref|XP_003525340.1| PREDICTED: GDSL esterase/lipase At4g10955-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|225426308|ref|XP_002268223.1| PREDICTED: GDSL esterase/lipase At4g10955 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449452218|ref|XP_004143857.1| PREDICTED: GDSL esterase/lipase At4g10955-like [Cucumis sativus] gi|449509371|ref|XP_004163569.1| PREDICTED: GDSL esterase/lipase At4g10955-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388512187|gb|AFK44155.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query344
TAIR|locus:2169764369 AT5G24230 [Arabidopsis thalian 0.997 0.929 0.557 7.2e-107
TAIR|locus:505006437350 AT4G10955 [Arabidopsis thalian 0.918 0.902 0.524 7.8e-94
TAIR|locus:2051289358 AT2G05260 [Arabidopsis thalian 0.834 0.801 0.503 2.1e-77
TAIR|locus:2151842375 AT5G24180 [Arabidopsis thalian 0.947 0.869 0.454 5.1e-74
TAIR|locus:2169754376 AT5G24220 [Arabidopsis thalian 0.936 0.856 0.437 9.6e-73
TAIR|locus:2151852344 AT5G24200 [Arabidopsis thalian 0.933 0.933 0.427 4.3e-70
TAIR|locus:2169809350 AT5G24210 [Arabidopsis thalian 0.924 0.908 0.385 3.3e-56
TAIR|locus:2157343408 AT5G50890 [Arabidopsis thalian 0.645 0.544 0.353 1.5e-43
TAIR|locus:2151847245 AT5G24190 [Arabidopsis thalian 0.607 0.853 0.430 7.5e-41
TAIR|locus:2169764 AT5G24230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1057 (377.1 bits), Expect = 7.2e-107, P = 7.2e-107
 Identities = 200/359 (55%), Positives = 270/359 (75%)

Query:     1 MAKQEAAVPEREIFSLSGPLYLTAVDWKNPHHRRAVAASLVRGVYILERDHQENRLGHQA 60
             M ++     +REIFS+SGP++LT++DW N +HR +VA+ LV+ VY LERD Q+NR+G ++
Sbjct:     9 MVREGLMASQREIFSISGPIHLTSIDWNNSYHRTSVASCLVQAVYTLERDRQQNRIGLKS 68

Query:    61 QASPWWNFFHFQLSRMLIDDVDYSVFGAIYEY-HSFAFDCN-------APKFVIAFRGTI 112
             QA+ WW FF+F L+  LIDD D S++GA++EY H F+++ +        P+ VIAFRGTI
Sbjct:    69 QANHWWEFFNFTLAETLIDDSDGSIYGAVFEYKHFFSYNYHHTPHSKPPPRHVIAFRGTI 128

Query:   113 KKPDTKSRDLKLDLQCISNRLHQSSRFQLSMQAIQNVISLVGAANIWLAGHSLGSAIALL 172
              KP ++SRDLKLDL+CI + LH S+RF  ++Q IQ+ ++  G A +WLAGHSLG+A+ALL
Sbjct:   129 LKPHSRSRDLKLDLRCIRDSLHDSTRFVHAIQVIQSAVAKTGNAAVWLAGHSLGAAVALL 188

Query:   173 AGKNMTRMGYPMETYLFNPPFPSVPIER-INNEKVKHGIRAASSVVKAGFAVAKKGQNQ- 230
             AGK MTR G+P+E+YLFNPPF S+PIE+ + +EK+KHG+R A S+VKAG A+A KG++  
Sbjct:   189 AGKIMTRSGFPLESYLFNPPFSSIPIEKLVKSEKLKHGVRFAGSLVKAGVAIAVKGRHHN 248

Query:   231 RSQKDDSFYALSEWVPGLFVNPADHICSEYIGYFEHRKKMEKIGGSKIERLATQYSIGSM 290
             + Q+DDSF  L+ W+P L++NP D ICSEYIGYF+HR KM +IG  KIER+AT+ S+ S+
Sbjct:   249 KGQEDDSFMKLASWIPYLYLNPLDTICSEYIGYFKHRNKMFEIGAGKIERIATRNSLRSL 308

Query:   291 ISGVFGG------DSEALHLLPSANLTINLSHCPDFKRAHGIHQWWDPNFLGQSELHLF 343
             +SG  GG       SE LHLLPSA +TIN S  P+FKRAHGIHQWWDP F G+  LH F
Sbjct:   309 LSGGGGGGSSSDSSSEPLHLLPSAYMTINASKSPNFKRAHGIHQWWDPMFNGEYVLHQF 367
GO:0004806 "triglyceride lipase activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006629 "lipid metabolic process" evidence=IEA
GO:0006865 "amino acid transport" evidence=RCA
TAIR|locus:505006437 AT4G10955 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051289 AT2G05260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151842 AT5G24180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169754 AT5G24220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151852 AT5G24200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169809 AT5G24210 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157343 AT5G50890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151847 AT5G24190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query344
cd00519229 cd00519, Lipase_3, Lipase (class 3) 1e-05
cd00741153 cd00741, Lipase, Lipase 3e-04
pfam01764141 pfam01764, Lipase_3, Lipase (class 3) 8e-04
>gnl|CDD|238287 cd00519, Lipase_3, Lipase (class 3) Back     alignment and domain information 
 Score = 45.5 bits (108), Expect = 1e-05
 Identities = 29/103 (28%), Positives = 39/103 (37%), Gaps = 17/103 (16%)

Query: 105 VIAFRGTIKKPDTKSRDLKLDLQCISNRLHQS----SRFQ-----LSMQAIQNVISLVGA 155
           VIAFRGT+   D  + DL      +   L       S F      L  Q +  + S +  
Sbjct: 66  VIAFRGTVSLADWLT-DLDFSPVPLDPPLCSGGKVHSGFYSAYKSLYNQVLPELKSALKQ 124

Query: 156 ---ANIWLAGHSLGSAIALLAG---KNMTRMGYPMETYLFNPP 192
                I + GHSLG A+A L     +     G  +  Y F  P
Sbjct: 125 YPDYKIIVTGHSLGGALASLLALDLRLR-GPGSDVTVYTFGQP 166

Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface. A typical feature of lipases is "interfacial activation," the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation . The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure. A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site. . Length = 229
>gnl|CDD|238382 cd00741, Lipase, Lipase Back     alignment and domain information
>gnl|CDD|216688 pfam01764, Lipase_3, Lipase (class 3) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 344
PLN02408365 phospholipase A1 99.96
PLN02324415 triacylglycerol lipase 99.95
PLN02753531 triacylglycerol lipase 99.95
PLN02761527 lipase class 3 family protein 99.95
PLN02310405 triacylglycerol lipase 99.95
PLN02719518 triacylglycerol lipase 99.95
PLN02802509 triacylglycerol lipase 99.95
PLN02454414 triacylglycerol lipase 99.95
PLN03037525 lipase class 3 family protein; Provisional 99.95
PLN02571413 triacylglycerol lipase 99.94
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 99.83
PLN02162475 triacylglycerol lipase 99.82
PLN02934515 triacylglycerol lipase 99.82
PLN00413479 triacylglycerol lipase 99.81
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 99.8
KOG4569336 consensus Predicted lipase [Lipid transport and me 99.77
PLN02847 633 triacylglycerol lipase 99.63
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 99.45
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 99.28
KOG4540425 consensus Putative lipase essential for disintegra 98.98
COG5153425 CVT17 Putative lipase essential for disintegration 98.98
COG3675332 Predicted lipase [Lipid metabolism] 97.76
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 97.22
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 96.93
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 96.84
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 96.77
PRK11071190 esterase YqiA; Provisional 96.53
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 96.46
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 96.32
PHA02857276 monoglyceride lipase; Provisional 96.16
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 95.93
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 95.88
COG2267298 PldB Lysophospholipase [Lipid metabolism] 95.86
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 95.77
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 95.72
PRK10749330 lysophospholipase L2; Provisional 95.71
PRK10985324 putative hydrolase; Provisional 95.7
PLN02733440 phosphatidylcholine-sterol O-acyltransferase 95.66
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 95.54
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 95.5
KOG2564343 consensus Predicted acetyltransferases and hydrola 95.49
COG3675332 Predicted lipase [Lipid metabolism] 95.48
PLN02965255 Probable pheophorbidase 95.48
KOG2088 596 consensus Predicted lipase/calmodulin-binding heat 95.47
PLN02824294 hydrolase, alpha/beta fold family protein 95.31
PRK10673255 acyl-CoA esterase; Provisional 95.24
TIGR03611257 RutD pyrimidine utilization protein D. This protei 95.19
PLN02511388 hydrolase 95.02
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 94.97
PLN02298330 hydrolase, alpha/beta fold family protein 94.78
PRK04940180 hypothetical protein; Provisional 94.7
PRK00870302 haloalkane dehalogenase; Provisional 94.68
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 94.62
COG3319257 Thioesterase domains of type I polyketide synthase 94.51
PRK13604307 luxD acyl transferase; Provisional 94.42
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 94.33
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 94.27
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 94.25
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 94.24
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 94.19
PRK03204286 haloalkane dehalogenase; Provisional 94.19
KOG3724 973 consensus Negative regulator of COPII vesicle form 94.08
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 94.05
PLN02385349 hydrolase; alpha/beta fold family protein 94.04
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 94.03
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 94.02
PRK03592295 haloalkane dehalogenase; Provisional 94.01
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 93.97
PLN02211273 methyl indole-3-acetate methyltransferase 93.88
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 93.79
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 93.76
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 93.76
PF02450389 LCAT: Lecithin:cholesterol acyltransferase; InterP 93.72
PLN02652395 hydrolase; alpha/beta fold family protein 93.7
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 93.7
COG3208244 GrsT Predicted thioesterase involved in non-riboso 93.61
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 93.27
PLN02894402 hydrolase, alpha/beta fold family protein 93.27
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 93.23
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 92.96
PRK10349256 carboxylesterase BioH; Provisional 92.84
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 92.77
PRK10566249 esterase; Provisional 92.76
COG3150191 Predicted esterase [General function prediction on 92.55
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 92.28
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 92.28
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 92.21
PLN02578354 hydrolase 92.11
PLN02679360 hydrolase, alpha/beta fold family protein 92.1
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 92.02
PRK08775343 homoserine O-acetyltransferase; Provisional 92.01
PRK10162318 acetyl esterase; Provisional 91.78
PLN02442283 S-formylglutathione hydrolase 91.56
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 91.35
PRK11460232 putative hydrolase; Provisional 91.22
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 90.91
PRK00175379 metX homoserine O-acetyltransferase; Provisional 90.91
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 90.91
KOG1455313 consensus Lysophospholipase [Lipid transport and m 90.8
PRK07581339 hypothetical protein; Validated 90.63
PRK06489360 hypothetical protein; Provisional 90.61
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 90.43
PLN00021313 chlorophyllase 89.49
PRK05855 582 short chain dehydrogenase; Validated 89.46
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 89.27
PF05277345 DUF726: Protein of unknown function (DUF726); Inte 88.9
PRK06765389 homoserine O-acetyltransferase; Provisional 88.65
PF08237225 PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum 88.54
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 88.5
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 88.3
KOG4627270 consensus Kynurenine formamidase [Amino acid trans 88.17
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 87.9
COG0657312 Aes Esterase/lipase [Lipid metabolism] 87.74
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 87.65
PLN03084383 alpha/beta hydrolase fold protein; Provisional 87.41
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 86.89
KOG2088596 consensus Predicted lipase/calmodulin-binding heat 86.56
PRK05077414 frsA fermentation/respiration switch protein; Revi 86.4
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 85.05
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 84.81
PF10503220 Esterase_phd: Esterase PHB depolymerase 84.38
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 84.28
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 83.97
PLN02872395 triacylglycerol lipase 83.57
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 83.54
COG1075336 LipA Predicted acetyltransferases and hydrolases w 83.13
PF03403379 PAF-AH_p_II: Platelet-activating factor acetylhydr 83.07
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 82.93
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 82.89
COG1647243 Esterase/lipase [General function prediction only] 81.43
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 80.49
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 80.43
>PLN02408 phospholipase A1 Back     alignment and domain information 
Probab=99.96  E-value=2.7e-29  Score=246.66  Aligned_cols=195  Identities=16%  Similarity=0.197  Sum_probs=138.5

Q ss_pred             CCC------CcchhhHHH--HHHHhhhhhh-hhhhhhhhcCCcCCCC------CCccccceeeeeeeeecccce------
Q 019209           26 DWK------NPHHRRAVA--ASLVRGVYIL-ERDHQENRLGHQAQAS------PWWNFFHFQLSRMLIDDVDYS------   84 (344)
Q Consensus        26 ~w~------~~~~Rr~v~--a~lvq~~Y~~-e~dr~~~r~~~~~~ap------~ww~~f~f~l~~~l~d~~d~s------   84 (344)
                      +|+      |+++||.|+  ++|||++|+. +.|+....++..-+.+      ..-...+|++++.|+..++-.      
T Consensus         8 ~W~glldPld~~LR~~iirYGe~~qa~yd~f~~d~~s~~~g~cry~~~~~~~~~~~~~~~Y~vt~~lyAts~~~~p~~~~   87 (365)
T PLN02408          8 NWDGLLDPLDDNLRGEILRYGDFVEAAYKSFDFDPSSPTYATCRFPKSTLLERSGLPNTGYRLTKHLRATSGIQLPRWIE   87 (365)
T ss_pred             ChhhhccccCHHHHHHHHHHHHHHHHHHHhhccCCCCccccccccchhhHHHHhCCCCCCceEEEEEEEecCCCCchhhh
Confidence            688      789999999  8899999997 4455443333221111      001245799999999876322      


Q ss_pred             -----------eEeEEEeec--cccccCCCCeEEEEEcCCCCCCCCcccchhhhhcccc------------------ccc
Q 019209           85 -----------VFGAIYEYH--SFAFDCNAPKFVIAFRGTIKKPDTKSRDLKLDLQCIS------------------NRL  133 (344)
Q Consensus        85 -----------i~gav~e~~--~~~~d~~~~~iVVAfRGT~~~~~s~~~D~~~Dl~~~~------------------~~v  133 (344)
                                 .+|-|-...  ......++++||||||||.+..     ||++|+++..                  ..|
T Consensus        88 ~~~~~~~~~s~w~GyVAv~~d~~~i~rlGrrdIVVafRGT~s~~-----dWi~DL~~~l~~~p~~~~~~~~~~~~~~~kV  162 (365)
T PLN02408         88 KAPSWVATQSSWIGYVAVCQDKEEIARLGRRDVVIAFRGTATCL-----EWLENLRATLTRLPNAPTDMNGSGDGSGPMV  162 (365)
T ss_pred             cccchhccccceeEEEEEccCcchhhccCCceEEEEEcCCCCHH-----HHHHHhhhceeecCCCCccccccCCCCCCee
Confidence                       122111110  0001234678999999998753     9999987532                  269


Q ss_pred             ccchh--H-----------HHHHHHHHHHHHHhCCc--cEEEeecchhHHHHHHHHHHHhhcCC---CeEEEEeCCCCCC
Q 019209          134 HQSSR--F-----------QLSMQAIQNVISLVGAA--NIWLAGHSLGSAIALLAGKNMTRMGY---PMETYLFNPPFPS  195 (344)
Q Consensus       134 H~Gf~--~-----------~~a~~~l~~l~~~~p~~--~I~itGHSLGGalA~Laa~~l~~~g~---~v~~~tFg~PrVg  195 (344)
                      |.||.  +           ++++++|++++++||+.  +|+|||||||||||+|+|.+++..+.   +|.+||||+||||
T Consensus       163 H~GFl~~Yts~~~~~~s~r~qVl~eI~~ll~~y~~~~~sI~vTGHSLGGALAtLaA~dl~~~~~~~~~V~v~tFGsPRVG  242 (365)
T PLN02408        163 ESGFLSLYTSGTAMGPSLQEMVREEIARLLQSYGDEPLSLTITGHSLGAALATLTAYDIKTTFKRAPMVTVISFGGPRVG  242 (365)
T ss_pred             cHhHHHHHhcccccchhHHHHHHHHHHHHHHhcCCCCceEEEeccchHHHHHHHHHHHHHHhcCCCCceEEEEcCCCCcc
Confidence            99987  2           35788899999999974  69999999999999999999997532   4889999999999


Q ss_pred             C-hhhhhccccccceEEecc--hhhhhhhhhhh
Q 019209          196 V-PIERINNEKVKHGIRAAS--SVVKAGFAVAK  225 (344)
Q Consensus       196 ~-~~~~~~~~~~~~~~r~~~--~~ik~g~~~~~  225 (344)
                      | .|.+..++...+.+||++  |+|+..+..++
T Consensus       243 N~~Fa~~~~~~~~~~lRVvN~~D~VP~vP~~~~  275 (365)
T PLN02408        243 NRSFRRQLEKQGTKVLRIVNSDDVITKVPGFVI  275 (365)
T ss_pred             cHHHHHHHHhcCCcEEEEEeCCCCcccCCCccc
Confidence            9 576665555667899974  78876665444

>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>KOG4569 consensus Predicted lipase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>KOG4540 consensus Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking, secretion, and vesicular transport; Lipid transport and metabolism] Back     alignment and domain information
>COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] Back     alignment and domain information
>COG3675 Predicted lipase [Lipid metabolism] Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>COG3675 Predicted lipase [Lipid metabolism] Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>KOG2088 consensus Predicted lipase/calmodulin-binding heat-shock protein [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>KOG2088 consensus Predicted lipase/calmodulin-binding heat-shock protein [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query344
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 6e-11
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 6e-10
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 1e-08
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 3e-08
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 5e-08
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 1e-07
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 1e-07
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 2e-07
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 7e-06
2yij_A419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 4e-04
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Length = 269 Back     alignment and structure
 Score = 61.1 bits (148), Expect = 6e-11
 Identities = 30/143 (20%), Positives = 53/143 (37%), Gaps = 20/143 (13%)

Query: 62  ASPWWNFFHFQLSRMLIDDVDYSVFGAIYEYHSFAFDCNAPKFVIAFRGTIKKPDTKSRD 121
           A P              D     V G +      A D      V++FRG+    +    +
Sbjct: 40  ACPEVEKADATFLYSFEDSGVGDVTGFL------ALDNTNKLIVLSFRGSRSIENWIG-N 92

Query: 122 LKLDLQCISN------------RLHQSSRFQLSMQAIQNVISLVGAANIWLAGHSLGSAI 169
           L  DL+ I++               +S    L  Q +++ +       +   GHSLG A+
Sbjct: 93  LNFDLKEINDICSGCRGHDGFTSSWRSVADTL-RQKVEDAVREHPDYRVVFTGHSLGGAL 151

Query: 170 ALLAGKNMTRMGYPMETYLFNPP 192
           A +AG ++   GY ++ + +  P
Sbjct: 152 ATVAGADLRGNGYDIDVFSYGAP 174
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Length = 319 Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Length = 261 Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Length = 269 Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Length = 279 Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Length = 258 Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} Length = 301 Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Length = 269 Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Length = 279 Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Length = 419 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query344
2yij_A419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 99.84
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 99.9
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 99.88
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 99.87
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 99.86
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 99.86
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 99.85
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 99.84
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 99.81
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 99.78
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 99.74
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 96.84
4fle_A202 Esterase; structural genomics, PSI-biology, northe 96.79
2qub_A 615 Extracellular lipase; beta roll, alpha/beta hydrol 96.7
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 96.62
3llc_A270 Putative hydrolase; structural genomics, joint cen 96.56
3h04_A275 Uncharacterized protein; protein with unknown func 96.56
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 96.5
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 96.44
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 96.4
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 96.37
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 96.35
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 96.34
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 96.33
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 96.24
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 96.23
3lp5_A250 Putative cell surface hydrolase; structural genom 96.21
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 96.17
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 96.15
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 96.13
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 96.11
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 96.11
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 96.1
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 96.1
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 96.05
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 96.04
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 96.04
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 96.04
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 96.04
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 96.02
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 96.01
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 95.99
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 95.99
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 95.99
1iup_A282 META-cleavage product hydrolase; aromatic compound 95.97
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 95.97
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 95.96
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 95.96
1vkh_A273 Putative serine hydrolase; structural genomics, jo 95.95
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 95.95
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 95.95
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 95.93
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 95.93
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 95.92
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 95.92
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 95.92
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 95.92
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 95.91
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 95.91
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 95.91
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 95.91
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 95.91
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 95.9
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 95.9
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 95.89
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 95.88
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 95.88
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 95.88
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 95.88
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 95.87
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 95.87
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 95.85
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 95.84
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 95.84
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 95.83
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 95.8
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 95.79
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 95.79
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 95.76
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 95.76
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 95.74
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 95.74
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 95.73
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 95.73
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 95.72
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 95.71
1r3d_A264 Conserved hypothetical protein VC1974; structural 95.71
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 95.7
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 95.68
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 95.68
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 95.68
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 95.64
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 95.61
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 95.6
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 95.57
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 95.57
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 95.56
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 95.55
3tej_A329 Enterobactin synthase component F; nonribosomal pe 95.55
3ain_A323 303AA long hypothetical esterase; carboxylesterase 95.55
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 95.53
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 95.52
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 95.5
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 95.5
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 95.48
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 95.48
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 95.47
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 95.47
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 95.46
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 95.46
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 95.4
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 95.4
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 95.38
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 95.37
1kez_A300 Erythronolide synthase; polyketide synthase, modul 95.37
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 95.35
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 95.34
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 95.34
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 95.31
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 95.31
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 95.27
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 95.26
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 95.25
2z8x_A 617 Lipase; beta roll, calcium binding protein, RTX pr 95.24
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 95.23
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 95.21
1qoz_A207 AXE, acetyl xylan esterase; hydrolase, xylan degra 95.21
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 95.15
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 95.13
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 95.09
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 95.07
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 95.05
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 95.05
1g66_A207 Acetyl xylan esterase II; serine hydrolase, acetyl 95.05
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 95.05
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 95.04
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 94.99
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 94.99
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 94.99
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 94.95
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 94.95
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 94.93
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 94.9
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 94.88
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 94.78
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 94.77
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 94.69
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 94.65
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 94.64
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 94.62
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 94.61
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 94.6
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 94.6
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 94.58
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 94.57
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 94.54
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 94.45
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 94.39
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 94.32
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 94.32
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 94.31
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 94.3
3qpd_A187 Cutinase 1; alpha-beta hydrolase fold, esterase, h 94.22
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 94.21
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 94.19
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 94.18
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 94.16
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 94.13
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 94.12
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 94.07
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 94.05
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 92.99
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 93.81
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 93.73
3bjr_A283 Putative carboxylesterase; structural genomics, jo 93.66
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 93.62
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 93.6
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 93.59
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 93.55
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 93.52
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 93.49
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 93.45
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 93.41
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 93.4
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 93.39
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 93.37
2dsn_A387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 93.34
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 93.32
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 93.21
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 93.2
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 93.19
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 93.18
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 93.02
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 92.94
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 92.84
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 92.67
3hc7_A254 Gene 12 protein, GP12; alpha/beta sandwich, cell a 92.53
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 92.5
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 92.34
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 92.33
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 92.2
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 92.19
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 92.19
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 92.13
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 92.0
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 91.77
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 91.65
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 91.44
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 91.3
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 91.11
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 90.67
3qpa_A197 Cutinase; alpha-beta hydrolase fold, esterase, hyd 90.45
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 90.32
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 90.04
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 89.87
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 89.86
2czq_A205 Cutinase-like protein; alpha/beta hydrolase fold, 89.41
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 89.19
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 89.09
3aja_A302 Putative uncharacterized protein; alpha-beta hydro 88.43
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 88.39
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 88.29
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 88.04
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 87.74
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 87.4
3dcn_A201 Cutinase, cutin hydrolase; catalytic triad, secret 87.04
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 86.57
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 86.13
3d59_A383 Platelet-activating factor acetylhydrolase; secret 85.92
3nuz_A398 Putative acetyl xylan esterase; structural genomic 85.38
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 83.71
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 83.51
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 83.21
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 83.18
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 83.17
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 83.03
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 82.92
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 82.79
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 82.63
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 82.57
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 82.46
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 81.92
4f21_A246 Carboxylesterase/phospholipase family protein; str 81.83
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 81.76
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 81.2
2hqs_H118 Peptidoglycan-associated lipoprotein; TOLB, PAL, T 80.78
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 80.44
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
Probab=99.84  E-value=6.2e-26  Score=225.84  Aligned_cols=227  Identities=13%  Similarity=0.206  Sum_probs=149.2

Q ss_pred             CcchhhHHH--HHHHhhhhhhh-hhhhh-----hhcCCcCCCCCC-c---ccc-ceeeeeeeeecccceeEeEEE-----
Q 019209           29 NPHHRRAVA--ASLVRGVYILE-RDHQE-----NRLGHQAQASPW-W---NFF-HFQLSRMLIDDVDYSVFGAIY-----   90 (344)
Q Consensus        29 ~~~~Rr~v~--a~lvq~~Y~~e-~dr~~-----~r~~~~~~ap~w-w---~~f-~f~l~~~l~d~~d~si~gav~-----   90 (344)
                      |+++|+.|+  ++|||++|+.. .|+..     ||++...+...- -   .++ .|++++.||.+++-.+-.++.     
T Consensus        40 d~~lr~~iirYGe~~qa~yd~f~~~~~s~~~g~~~y~~~~~~~~~~~~~~~~~~~Y~vt~~lyat~~~~~p~~~~~~~~~  119 (419)
T 2yij_A           40 DQDLREYIIHYGEMAQAGYDTFNINTESQFAGASIYSRKDFFAKVGLEIAHPYTKYKVTKFIYATSDIHVPESFLLFPIS  119 (419)
Confidence            789999999  88999999974 34332     344332221111 0   124 799999999876533332221     


Q ss_pred             --eecc-c------cccC-------CCCeEEEEEcCCCCCCCCcccchhhhhcccc-------------cccccchhH--
Q 019209           91 --EYHS-F------AFDC-------NAPKFVIAFRGTIKKPDTKSRDLKLDLQCIS-------------NRLHQSSRF--  139 (344)
Q Consensus        91 --e~~~-~------~~d~-------~~~~iVVAfRGT~~~~~s~~~D~~~Dl~~~~-------------~~vH~Gf~~--  139 (344)
                        .|.+ +      +.++       +++.||||||||.+..     ||++|+.+..             ..||.||+.  
T Consensus       120 ~~~w~~~s~~~GYVAv~~d~~~~~lGrk~IVVafRGT~s~~-----DWltDL~~~~~~~~~~~g~~~~~~kVH~GF~~ay  194 (419)
T 2yij_A          120 REGWSKESNWMGYVAVTDDQGTALLGRRDIVVSWRGSVQPL-----EWVEDFEFGLVNAIKIFGERNDQVQIHQGWYSIY  194 (419)
Confidence              1211 1      1332       2579999999998754     9999986543             258999872  


Q ss_pred             ---------------HHHHHHHHHHHHHhCC--ccEEEeecchhHHHHHHHHHHHhhcC-----------CCeEEEEeCC
Q 019209          140 ---------------QLSMQAIQNVISLVGA--ANIWLAGHSLGSAIALLAGKNMTRMG-----------YPMETYLFNP  191 (344)
Q Consensus       140 ---------------~~a~~~l~~l~~~~p~--~~I~itGHSLGGalA~Laa~~l~~~g-----------~~v~~~tFg~  191 (344)
                                     +++++.|++++++||+  ++|+|||||||||||+|+|.+|...+           .++.|||||+
T Consensus       195 ~~~~~~~~f~~~s~r~~Vl~~l~~ll~~yp~~~~~I~vTGHSLGGALA~L~A~~L~~~~~~~~~~~~~~~~~v~vyTFGs  274 (419)
T 2yij_A          195 MSQDERSPFTKTNARDQVLREVGRLLEKYKDEEVSITICGHSLGAALATLSATDIVANGYNRPKSRPDKSCPVTAFVFAS  274 (419)
Confidence                           3457788889999987  89999999999999999999998643           2589999999


Q ss_pred             CCCCC-hhhhhcccc-ccceEEec--chhhhhhhhhhhccccccCcchhhhhcccCCcccccccCCCcccccccchhhhH
Q 019209          192 PFPSV-PIERINNEK-VKHGIRAA--SSVVKAGFAVAKKGQNQRSQKDDSFYALSEWVPGLFVNPADHICSEYIGYFEHR  267 (344)
Q Consensus       192 PrVg~-~~~~~~~~~-~~~~~r~~--~~~ik~g~~~~~~~~~~~~~~~~~f~~l~~WvP~lyvn~~D~ic~~yi~yf~~r  267 (344)
                      ||||+ .|.+..++. -.+.+|++  +|+|+..+..    .+.+.+.+-.+.  ..=.|+|- .+++++|++-++.|.|-
T Consensus       275 PRVGn~~Fa~~~~~~~~~~~~RVvn~~DiVP~lPp~----gY~HvG~ev~id--~~~spylk-~~~~~~~~H~Le~Ylh~  347 (419)
T 2yij_A          275 PRVGDSDFRKLFSGLEDIRVLRTRNLPDVIPIYPPI----GYSEVGDEFPID--TRKSPYMK-SPGNLATFHCLEGYLHG  347 (419)
Confidence            99998 565554433 24567776  4777654431    222222121111  01123332 35689999999888774
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>2qub_A Extracellular lipase; beta roll, alpha/beta hydrolase, helical hairpin, hydrolase; 1.80A {Serratia marcescens} PDB: 2qua_A Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>2z8x_A Lipase; beta roll, calcium binding protein, RTX protein, hydrolase; 1.48A {Pseudomonas SP} PDB: 2zvd_A 3a6z_A 3a70_A* 2z8z_A 2zj6_A 2zj7_A Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis} Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>2hqs_H Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: d.79.7.1 PDB: 2w8b_C 1oap_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 344
d1tiba_269 c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces 2e-05
d1uwca_261 c.69.1.17 (A:) Feruloyl esterase A {Aspergillus ni 6e-05
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Length = 269 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Fungal lipases
domain: Triacylglycerol lipase
species: Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]

 Score = 43.0 bits (100), Expect = 2e-05
 Identities = 26/108 (24%), Positives = 45/108 (41%), Gaps = 12/108 (11%)

Query: 96  AFDCNAPKFVIAFRGTIKKPDTKSRDLKLDLQ-----CISNRLHQS------SRFQLSMQ 144
           A D      V++FRG+    +    +L  DL+     C   R H        S      Q
Sbjct: 68  ALDNTNKLIVLSFRGSRSIENWIG-NLNFDLKEINDICSGCRGHDGFTSSWRSVADTLRQ 126

Query: 145 AIQNVISLVGAANIWLAGHSLGSAIALLAGKNMTRMGYPMETYLFNPP 192
            +++ +       +   GHSLG A+A +AG ++   GY ++ + +  P
Sbjct: 127 KVEDAVREHPDYRVVFTGHSLGGALATVAGADLRGNGYDIDVFSYGAP 174
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Length = 261 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query344
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 99.91
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 99.9
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 99.89
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 99.89
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 99.88
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 97.2
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 96.88
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 96.78
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 96.6
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 96.34
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 96.31
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 96.23
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 96.12
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 96.06
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 96.04
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 95.92
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 95.89
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 95.88
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 95.88
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 95.86
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 95.74
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 95.66
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 95.61
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 95.51
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 95.32
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 95.3
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 95.19
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 95.07
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 94.86
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 94.83
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 94.79
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 94.68
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 94.64
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 94.39
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 94.26
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 94.13
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 94.06
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 94.04
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 94.0
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 93.88
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 93.51
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 93.4
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 93.24
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 92.96
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 92.29
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 92.09
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 92.07
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 91.9
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 91.52
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 91.4
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 89.97
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 89.51
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 88.88
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 88.81
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 87.97
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 87.85
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 87.48
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 86.1
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 85.51
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 84.74
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 84.39
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 83.22
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 83.13
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 82.79
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 82.59
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 82.24
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 81.62
d2hqsc1106 Peptidoglycan-associated lipoprotein, PAL, peripla 80.86
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Fungal lipases
domain: Triacylglycerol lipase
species: Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]

Probab=99.91  E-value=4.6e-24  Score=199.35  Aligned_cols=119  Identities=19%  Similarity=0.256  Sum_probs=98.0

Q ss_pred             cCCCCeEEEEEcCCCCCCCCcccchhhhhcccc---------cccccchh------HHHHHHHHHHHHHHhCCccEEEee
Q 019209           98 DCNAPKFVIAFRGTIKKPDTKSRDLKLDLQCIS---------NRLHQSSR------FQLSMQAIQNVISLVGAANIWLAG  162 (344)
Q Consensus        98 d~~~~~iVVAfRGT~~~~~s~~~D~~~Dl~~~~---------~~vH~Gf~------~~~a~~~l~~l~~~~p~~~I~itG  162 (344)
                      |+.++.||||||||.+..     ||++|+++..         ..+|.||+      .+++.+.|+++++++|+++|+|||
T Consensus        70 d~~~k~ivvafRGT~s~~-----dw~~Dl~~~~~~~~~~~~~~~vH~GF~~~~~~~~~~v~~~v~~~~~~~~~~~i~vtG  144 (269)
T d1tiba_          70 DNTNKLIVLSFRGSRSIE-----NWIGNLNFDLKEINDICSGCRGHDGFTSSWRSVADTLRQKVEDAVREHPDYRVVFTG  144 (269)
T ss_dssp             ETTTTEEEEEECCCSCTH-----HHHTCCCCCEEECTTTSTTCEEEHHHHHHHHHHHHHHHHHHHHHHHHCTTSEEEEEE
T ss_pred             eCCCCEEEEEECCCCCHH-----HHHHhcCccceecccCCCCcEeeHHHHHHHHHHHHHHHHHHHHHHHhCCCcceeeec
Confidence            566899999999998653     9999997653         26999997      356778888899999999999999


Q ss_pred             cchhHHHHHHHHHHHhhcCCCeEEEEeCCCCCCC-hhhhhcccccc-ceEEec--chhhhhhh
Q 019209          163 HSLGSAIALLAGKNMTRMGYPMETYLFNPPFPSV-PIERINNEKVK-HGIRAA--SSVVKAGF  221 (344)
Q Consensus       163 HSLGGalA~Laa~~l~~~g~~v~~~tFg~PrVg~-~~~~~~~~~~~-~~~r~~--~~~ik~g~  221 (344)
                      ||||||+|+|+|.+|...+.++.+||||+||||+ .|.+..++... +.+|++  +|+|+..+
T Consensus       145 HSLGGalA~l~a~~l~~~~~~i~~~tFG~PrvGn~~fa~~~~~~~~~~~~Rvv~~~D~VP~lP  207 (269)
T d1tiba_         145 HSLGGALATVAGADLRGNGYDIDVFSYGAPRVGNRAFAEFLTVQTGGTLYRITHTNDIVPRLP  207 (269)
T ss_dssp             ETHHHHHHHHHHHHHTTSSSCEEEEEESCCCCBCHHHHHHHHHCTTSCEEEEEETTBSGGGCS
T ss_pred             cchHHHHHHHHHHHHHhccCcceEEEecCCCcCCHHHHHHHHhhcCCceEEEEeCCCeeeeCC
Confidence            9999999999999999988999999999999999 67666444443 346886  57776433
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2hqsc1 d.79.7.1 (C:68-173) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure