Citrus Sinensis ID: 019231

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340----

MAYNDQQNMQRLVLPTTSTNPPPPTWLNNAVRHHHHQNNDDDDDDEEEAPKNNKNNSASNDNGRAEDWETVKCKAEIVGHPLYEQLLSAHVSCLRIATPVDQLPKIDAQLSRSRDVLAKYSAVANGRVLDDKELDQFMTHYVLLLYSFKEQLQQHVRVHAMEAVMACWDLEQSLQSLTGVSPGESTGATMSDDDEDQVDSDTNFFDGSLDGPDSMGFGPLVPTESERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWLSHAKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWHANPSSSTASKSKRKSNAGKSSNENFM

ccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccHHHHHHHHcccccccccccHHcHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccHHHHHcccccccccccccc

*******************************************************************WETVKCKAEIVGHPLYEQLLSAHVSCLRIATPVDQLPKIDAQLSRSRDVLAKYSAVANGRVLDDKELDQFMTHYVLLLYSFKEQLQQHVRVHAMEAVMACWDLEQS**********************************************************************GYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWLSHAKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNW***************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Homeobox protein knotted-1-like 3		probable	P48000
Homeobox protein knotted-1-like 13	Isoform 3 acts as trancription activator, but isoforms 1 and 2 do not.	probable	Q0J6N4
Homeobox protein knotted-1-like 2		probable	Q0E3C3

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1X2N, chain A
Confidence level:very confident
Coverage over the Query: 258-323
View the alignment between query and template
View the model in PyMOL