Citrus Sinensis ID: 019285


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340---
MELDLLWLILAIAAGSYIIVYAFVRRVNEWYHVSKLGEKRHFLPPGDMGWPFLGNMPSFLRAYRSNNPETFIDSIVERYGRTGVYKTHLFGNPSIIVSSPQTCRRVLMDDEKFGLGYGKSMTRLAGKNTFVNIAKSEHRRLRKMMTSLMISHEALVMYIGNTEDVAIASLEEWAAASKDEPIEFFCETSKLSLKFIMRILFGSTSDSIFSSVEKHYIDVHDGVHSTAINLPGFAFHKALKVIDETLRLMNLPFLDFREAKTDANIKGYTIPKGWKVLIWNRAVHMDPENFSAPKEFDPSRWDNNAAEPGSFIPFGGGSRRCLGIDVAKIEVSIFLHYFLLNYK
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHccccccEEccccccEEEEEcHHHHcHHccccccEEEcccHHHHHHcccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHccccccccccccccEEEccEEcccccEEEEEccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHccccEEEEEEccccEEEEEcHHHHHHHHcccHHHcccccccHHHHHccccHEHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEcEEEccEEEccccEEEEEHHHHccccccccccccccHHHcccccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHcc
MELDLLWLILAIAAGSYIIVYAFVRRVNEWYHVsklgekrhflppgdmgwpflgnmpsflrayrsnnpetFIDSIVERygrtgvykthlfgnpsiivsspqtcRRVLmddekfglgygksmtrlagkntFVNIAKSEHRRLRKMMTSLMISHEALVMYIGNTEDVAIASLEEWAaaskdepiefFCETSKLSLKFIMRILfgstsdsifSSVEKHYidvhdgvhstainlpgfaFHKALKVIDETLrlmnlpfldfreaktdanikgytipkgWKVLIWNRavhmdpenfsapkefdpsrwdnnaaepgsfipfgggsrrclGIDVAKIEVSIFLHYFLLNYK
MELDLLWLILAIAAGSYIIVYAFVRRVNEWYHVSKLGEKRHFLPPGDMGWPFLGNMPSFLRAYRSNNPETFIDSIVERYGRTGVykthlfgnpsiivsspqTCRRVLMDDEKFGLgygksmtrlagkntfvniAKSEHRRLRKMMTSLMISHEALVMYIGNTEDVAIASLEEWAAASKDEPIEFFCETSKLSLKFIMRILFGSTSDSIFSSVEKHYIDVHDGVHSTAINLPGFAFHKALKVIDETLRLMNLPFLDFREAktdanikgytipkgWKVLIWNRAVHMDPENFSAPKEFDPSRWDNNAAEPGSFIPFGGGSRRCLGIDVAKIEVSIFLHYFLLNYK
MEldllwlilaiaaGSYIIVYAFVRRVNEWYHVSKLGEKRHFLPPGDMGWPFLGNMPSFLRAYRSNNPETFIDSIVERYGRTGVYKTHLFGNPSIIVSSPQTCRRVLMDDEKFGLGYGKSMTRLAGKNTFVNIAKSEHRRLRKMMTSLMISHEALVMYIGNTEDVAIASLEEWAAASKDEPIEFFCETSKLSLKFIMRILFGSTSDSIFSSVEKHYIDVHDGVHSTAINLPGFAFHKALKVIDETLRLMNLPFLDFREAKTDANIKGYTIPKGWKVLIWNRAVHMDPENFSAPKEFDPSRWDNNAAEPGSFIPFGGGSRRCLGIDVAKIEVSIFLHYFLLNYK
**LDLLWLILAIAAGSYIIVYAFVRRVNEWYHVSKLGEKRHFLPPGDMGWPFLGNMPSFLRAYRSNNPETFIDSIVERYGRTGVYKTHLFGNPSIIVSSPQTCRRVLMDDEKFGLGYGKSMTRLAGKNTFVNIAKSEHRRLRKMMTSLMISHEALVMYIGNTEDVAIASLEEWAAASKDEPIEFFCETSKLSLKFIMRILFGSTSDSIFSSVEKHYIDVHDGVHSTAINLPGFAFHKALKVIDETLRLMNLPFLDFREAKTDANIKGYTIPKGWKVLIWNRAVHM************************SFIPFGGGSRRCLGIDVAKIEVSIFLHYFLLNY*
MELDLLWLILAIAAGSYIIVYAFVRRVNEWYHV***********PGDMGWPFLGNMPSFLRAYRSNNPETFIDSIVERYGRTGVYKTHLFGNPSIIVSSPQTCRRVLMDDEKFGLGYGKSMTRLAGKNTFVNIAKSEHRRLR*****************GNTEDVAIASLEEWAAASKDEPIEFFCETSKLSLKFIMRILFGSTSDSIFSSVEKHYIDVHDGVHSTAINLPGFAFHKALKVIDETLRLMNLPFLDFREAKTDANIKGYTIPKGWKVLIWNRAVHMDPENFSAPKEFDPSRWDNNAAEPGSFIPFGGGSRRCLGIDVAKIEVSIFLHYFLLNYK
MELDLLWLILAIAAGSYIIVYAFVRRVNEWYHVSKLGEKRHFLPPGDMGWPFLGNMPSFLRAYRSNNPETFIDSIVERYGRTGVYKTHLFGNPSIIVSSPQTCRRVLMDDEKFGLGYGKSMTRLAGKNTFVNIAKSEHRRLRKMMTSLMISHEALVMYIGNTEDVAIASLEEWAAASKDEPIEFFCETSKLSLKFIMRILFGSTSDSIFSSVEKHYIDVHDGVHSTAINLPGFAFHKALKVIDETLRLMNLPFLDFREAKTDANIKGYTIPKGWKVLIWNRAVHMDPENFSAPKEFDPSRWDNNAAEPGSFIPFGGGSRRCLGIDVAKIEVSIFLHYFLLNYK
*ELDLLWLILAIAAGSYIIVYAFVRRVNEWYHVSKLGEKRHFLPPGDMGWPFLGNMPSFLRAYRSNNPETFIDSIVERYGRTGVYKTHLFGNPSIIVSSPQTCRRVLMDDEKFGLGYGKSMTRLAGKNTFVNIAKSEHRRLRKMMTSLMISHEALVMYIGNTEDVAIASLEEWAAASKDEPIEFFCETSKLSLKFIMRILFGSTSDSIFSSVEKHYIDVHDGVHSTAINLPGFAFHKALKVIDETLRLMNLPFLDFREAKTDANIKGYTIPKGWKVLIWNRAVHMDPENFSAPKEFDPSRWDNNAAEPGSFIPFGGGSRRCLGIDVAKIEVSIFLHYFLLNYK
ooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELDLLWLILAIAAGSYIIVYAFVRRVNEWYHVSKLGEKRHFLPPGDMGWPFLGNMPSFLRAYRSNNPETFIDSIVERYGRTGVYKTHLFGNPSIIVSSPQTCRRVLMDDEKFGLGYGKSMTRLAGKNTFVNIAKSEHRRLRKMMTSLMISHEALVMYIGNTEDVAIASLEEWAAASKDEPIEFFCETSKLSLKFIMRILFGSTSDSIFSSVEKHYIDVHDGVHSTAINLPGFAFHKALKVIDETLRLMNLPFLDFREAKTDANIKGYTIPKGWKVLIWNRAVHMDPENFSAPKEFDPSRWDNNAAEPGSFIPFGGGSRRCLGIDVAKIEVSIFLHYFLLNYK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query343 2.2.26 [Sep-21-2011]
Q9C5Y2 489 Ent-kaurenoic acid oxidas yes no 0.679 0.476 0.474 1e-61
B5BSX1 493 Beta-amyrin 11-oxidase OS N/A no 0.740 0.515 0.428 3e-59
O23051 490 Ent-kaurenoic acid oxidas no no 0.626 0.438 0.454 1e-56
Q9AXH9 499 Ent-kaurenoic acid oxidas N/A no 0.623 0.428 0.386 2e-48
Q43246 519 Cytochrome P450 88A1 OS=Z N/A no 0.699 0.462 0.356 3e-40
Q94IW5490 Cytochrome P450 90D2 OS=O no no 0.285 0.2 0.456 9e-22
Q42569472 Cytochrome P450 90A1 OS=A no no 0.297 0.216 0.466 9e-22
Q94IA6491 3-epi-6-deoxocathasterone no no 0.279 0.195 0.451 1e-21
Q9LJK2468 Abscisic acid 8'-hydroxyl no no 0.300 0.220 0.461 3e-21
Q9M066524 3-epi-6-deoxocathasterone no no 0.297 0.194 0.485 1e-20
>sp|Q9C5Y2|KAO2_ARATH Ent-kaurenoic acid oxidase 2 OS=Arabidopsis thaliana GN=KAO2 PE=2 SV=2 Back     alignment and function desciption
 Score =  236 bits (603), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 113/238 (47%), Positives = 166/238 (69%), Gaps = 5/238 (2%)

Query: 3   LDLLWLILAIAAGSYIIVYAFVRRVNEWYHVSKLGEKRHFLPPGDMGWPFLGNMPSFLRA 62
           L L+W  L I  G +++ +  ++RVN W +VSKLGEK+H+LPPGD+GWP +GNM SFLRA
Sbjct: 6   LILMWFPLIIL-GLFVLKWV-LKRVNVWIYVSKLGEKKHYLPPGDLGWPVIGNMWSFLRA 63

Query: 63  YRSNNPETFIDSIVERYGRTGVYKTHLFGNPSIIVSSPQTCRRVLMDDEKFGLGYGKSMT 122
           +++++PE+FI S + RYGRTG+YK H+FG P ++V++P+TCRRVL DD+ F +G+ KS  
Sbjct: 64  FKTSDPESFIQSYITRYGRTGIYKAHMFGYPCVLVTTPETCRRVLTDDDAFHIGWPKSTM 123

Query: 123 RLAGKNTFVNIAKSEHRRLRKMMTSLMISHEALVMYIGNTEDVAIASLEEWAAASKDEPI 182
           +L G+ +FV I+  EH+RLR++ ++ +   EAL +YI   E+     LE+W   SK   I
Sbjct: 124 KLIGRKSFVGISFEEHKRLRRLTSAPVNGPEALSVYIQFIEETVNTDLEKW---SKMGEI 180

Query: 183 EFFCETSKLSLKFIMRILFGSTSDSIFSSVEKHYIDVHDGVHSTAINLPGFAFHKALK 240
           EF     KL+ K IM I   S S+ +  S+E+ Y +++ GV +  INLPGFA+H+ALK
Sbjct: 181 EFLSHLRKLTFKVIMYIFLSSESEHVMDSLEREYTNLNYGVRAMGINLPGFAYHRALK 238




Catalyzes three successive oxidations of ent-kaurenoic acid giving gibberellin 12 (GA12), a key step in gibberellins (GAs) biosynthesis. GAs, which are involved many processes, including stem elongation, play a central role in plant development.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: 7EC: 9
>sp|B5BSX1|BAMO_GLYUR Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 Back     alignment and function description
>sp|O23051|KAO1_ARATH Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thaliana GN=KAO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9AXH9|KAO1_HORVU Ent-kaurenoic acid oxidase 1 OS=Hordeum vulgare GN=KAO1 PE=1 SV=1 Back     alignment and function description
>sp|Q43246|C88A1_MAIZE Cytochrome P450 88A1 OS=Zea mays GN=CYP88A1 PE=2 SV=1 Back     alignment and function description
>sp|Q94IW5|C90D2_ORYSJ Cytochrome P450 90D2 OS=Oryza sativa subsp. japonica GN=CYP90D2 PE=1 SV=1 Back     alignment and function description
>sp|Q42569|C90A1_ARATH Cytochrome P450 90A1 OS=Arabidopsis thaliana GN=CYP90A1 PE=2 SV=1 Back     alignment and function description
>sp|Q94IA6|C90D1_ARATH 3-epi-6-deoxocathasterone 23-monooxygenase OS=Arabidopsis thaliana GN=CYP90D1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LJK2|ABAH4_ARATH Abscisic acid 8'-hydroxylase 4 OS=Arabidopsis thaliana GN=CYP707A4 PE=2 SV=2 Back     alignment and function description
>sp|Q9M066|C90C1_ARATH 3-epi-6-deoxocathasterone 23-monooxygenase OS=Arabidopsis thaliana GN=ROT3 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query343
449461565412 PREDICTED: beta-amyrin 11-oxidase-like [ 0.935 0.779 0.434 4e-88
357482355 491 Cytochrome P450 ent-kaurenoic acid oxida 0.702 0.490 0.491 6e-62
356555948 494 PREDICTED: ent-kaurenoic acid oxidase 2- 0.693 0.481 0.460 2e-61
356495547 493 PREDICTED: ent-kaurenoic acid oxidase 2- 0.705 0.490 0.493 2e-61
27764531 488 ent-kaurenoic acid oxidase [Pisum sativu 0.690 0.485 0.458 1e-60
62319849406 putative cytochrome P450 [Arabidopsis th 0.679 0.573 0.474 6e-60
13021856 489 ent-kaurenoic acid hydroxylase [Arabidop 0.679 0.476 0.474 9e-60
15225685 489 Ent-kaurenoic acid oxidase 2 [Arabidopsi 0.679 0.476 0.474 9e-60
225453226 492 PREDICTED: ent-kaurenoic acid oxidase 2 0.693 0.483 0.456 3e-59
356529016 496 PREDICTED: ent-kaurenoic acid oxidase 1- 0.673 0.465 0.461 4e-59
>gi|449461565|ref|XP_004148512.1| PREDICTED: beta-amyrin 11-oxidase-like [Cucumis sativus] gi|449513627|ref|XP_004164378.1| PREDICTED: beta-amyrin 11-oxidase-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  331 bits (848), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 159/366 (43%), Positives = 225/366 (61%), Gaps = 45/366 (12%)

Query: 16  SYIIVYAFVRRVNEWYHVSKLGEKRHFLPPGDMGWPFLGNMPSFLRAYRSNNPETFIDSI 75
           SY  V+  ++ +N+W+ +++ G +R+ LPPGDMGWP +G + SFL+A+RS  P+ FI   
Sbjct: 15  SYTFVFLILKNLNQWWFITRHG-RRYNLPPGDMGWPLIGTLLSFLQAFRSGRPDLFIHQF 73

Query: 76  VERY----------GRTGVYKTHLFGNPSIIVSSPQTCRRVLMDDEKFGLGYGKSMTRLA 125
             +Y          G+ G+YKT+LFG+PS+IV++P+ CR VLM+DE+FG GY K+   L 
Sbjct: 74  AYKYYFSLSPSVLYGKIGMYKTYLFGSPSVIVTAPEVCRHVLMNDEQFGFGYSKATRILT 133

Query: 126 GKNTFVNIAKSEHRRLRKMMTSLMISHEALVMYIGNTEDVAIASLEEWAAASKDEPIEFF 185
           G      + + EHRRLR+++ SL+  +EAL +YIG+ E + +  LEEWA+  K  P+EF 
Sbjct: 134 GGKALNTVPRPEHRRLRRLIASLISGNEALSLYIGHVEGIVVTCLEEWASMKK--PVEFL 191

Query: 186 CETSKLSLKFIMRILFGSTSDSIFSSVEKHYIDVHDGVHSTAINLPGFAFHKALK----- 240
            E   ++ K ++ I  G+ + +    +EK Y D H G  S+ ++LPG  F +ALK     
Sbjct: 192 SEMKTVAFKVLLHIFIGANTAAFIDRMEKLYNDFHLGFMSSPVDLPGTTFSRALKAEQEQ 251

Query: 241 ---------------------------VIDETLRLMNLPFLDFREAKTDANIKGYTIPKG 273
                                      VIDETLR  +L F   RE K D N+ GYTIPKG
Sbjct: 252 IVKARPADAQHKGLTMKEIKQMEYLYKVIDETLRKTSLAFTLSRETKVDVNLNGYTIPKG 311

Query: 274 WKVLIWNRAVHMDPENFSAPKEFDPSRWDNNAAEPGSFIPFGGGSRRCLGIDVAKIEVSI 333
           WK+L+W RAVHMDPE +  P++FDPSRWDN     GSFIPFG G R C GID++K+E++I
Sbjct: 312 WKILVWTRAVHMDPEIYENPQKFDPSRWDNPKRRAGSFIPFGAGMRLCPGIDLSKLEIAI 371

Query: 334 FLHYFL 339
           FLHYF+
Sbjct: 372 FLHYFI 377




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|357482355|ref|XP_003611463.1| Cytochrome P450 ent-kaurenoic acid oxidase [Medicago truncatula] gi|355512798|gb|AES94421.1| Cytochrome P450 ent-kaurenoic acid oxidase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356555948|ref|XP_003546291.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356495547|ref|XP_003516638.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Glycine max] Back     alignment and taxonomy information
>gi|27764531|gb|AAO23063.1| ent-kaurenoic acid oxidase [Pisum sativum] Back     alignment and taxonomy information
>gi|62319849|dbj|BAD93885.1| putative cytochrome P450 [Arabidopsis thaliana] gi|110740382|dbj|BAF02086.1| putative cytochrome P450 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|13021856|gb|AAK11565.1|AF318501_1 ent-kaurenoic acid hydroxylase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15225685|ref|NP_180803.1| Ent-kaurenoic acid oxidase 2 [Arabidopsis thaliana] gi|334184636|ref|NP_001189657.1| Ent-kaurenoic acid oxidase 2 [Arabidopsis thaliana] gi|50401152|sp|Q9C5Y2.2|KAO2_ARATH RecName: Full=Ent-kaurenoic acid oxidase 2; Short=AtKAO2; AltName: Full=Cytochrome P450 88A4 gi|3831452|gb|AAC69934.1| putative cytochrome P450 [Arabidopsis thaliana] gi|115646746|gb|ABJ17103.1| At2g32440 [Arabidopsis thaliana] gi|330253591|gb|AEC08685.1| Ent-kaurenoic acid oxidase 2 [Arabidopsis thaliana] gi|330253592|gb|AEC08686.1| Ent-kaurenoic acid oxidase 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225453226|ref|XP_002265630.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356529016|ref|XP_003533093.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query343
TAIR|locus:2062623 489 KAO2 "ent-kaurenoic acid hydro 0.647 0.453 0.477 1e-90
TAIR|locus:2207240 490 CYP88A3 ""cytochrome P450, fam 0.623 0.436 0.460 2.4e-87
UNIPROTKB|Q5VRM7 506 OSJNBa0004I20.18 "Putative cyt 0.717 0.486 0.388 5.8e-50
TAIR|locus:2094058468 CYP707A4 ""cytochrome P450, fa 0.300 0.220 0.461 8e-45
TAIR|locus:2166439472 CPD "CONSTITUTIVE PHOTOMORPHOG 0.297 0.216 0.466 2.5e-43
TAIR|locus:2091571491 CYP90D1 ""cytochrome P450, fam 0.303 0.211 0.451 1.1e-42
TAIR|locus:2134781484 CYP707A1 ""cytochrome P450, fa 0.300 0.212 0.451 2.1e-41
UNIPROTKB|Q6F4F5 480 CYP724B1 "Cytochrome P450 724B 0.568 0.406 0.275 2.4e-40
TAIR|locus:2115220524 ROT3 "ROTUNDIFOLIA 3" [Arabido 0.297 0.194 0.485 5.8e-40
TAIR|locus:2158961 477 CYP716A1 ""cytochrome P450, fa 0.565 0.406 0.303 8.5e-38
TAIR|locus:2062623 KAO2 "ent-kaurenoic acid hydroxylase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 588 (212.0 bits), Expect = 1.0e-90, Sum P(2) = 1.0e-90
 Identities = 108/226 (47%), Positives = 160/226 (70%)

Query:    15 GSYIIVYAFVRRVNEWYHVSKLGEKRHFLPPGDMGWPFLGNMPSFLRAYRSNNPETFIDS 74
             G +++ +  ++RVN W +VSKLGEK+H+LPPGD+GWP +GNM SFLRA+++++PE+FI S
Sbjct:    17 GLFVLKWV-LKRVNVWIYVSKLGEKKHYLPPGDLGWPVIGNMWSFLRAFKTSDPESFIQS 75

Query:    75 IVERYGRTGVYKTHLFGNPSIIVSSPQTCRRVLMDDEKFGLGYGKSMTRLAGKNTFVNIA 134
              + RYGRTG+YK H+FG P ++V++P+TCRRVL DD+ F +G+ KS  +L G+ +FV I+
Sbjct:    76 YITRYGRTGIYKAHMFGYPCVLVTTPETCRRVLTDDDAFHIGWPKSTMKLIGRKSFVGIS 135

Query:   135 KSEHRRLRKMMTSLMISHEALVMYIGNTEDVAIASLEEWAAASKDEPIEFFCETSKLSLK 194
               EH+RLR++ ++ +   EAL +YI   E+     LE+W   SK   IEF     KL+ K
Sbjct:   136 FEEHKRLRRLTSAPVNGPEALSVYIQFIEETVNTDLEKW---SKMGEIEFLSHLRKLTFK 192

Query:   195 FIMRILFGSTSDSIFSSVEKHYIDVHDGVHSTAINLPGFAFHKALK 240
              IM I   S S+ +  S+E+ Y +++ GV +  INLPGFA+H+ALK
Sbjct:   193 VIMYIFLSSESEHVMDSLEREYTNLNYGVRAMGINLPGFAYHRALK 238


GO:0004497 "monooxygenase activity" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009686 "gibberellin biosynthetic process" evidence=ISS;TAS
GO:0019825 "oxygen binding" evidence=ISS
GO:0051777 "ent-kaurenoate oxidase activity" evidence=IDA
GO:0005783 "endoplasmic reticulum" evidence=IDA
TAIR|locus:2207240 CYP88A3 ""cytochrome P450, family 88, subfamily A, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VRM7 OSJNBa0004I20.18 "Putative cytochrome P450 DWARF3" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2094058 CYP707A4 ""cytochrome P450, family 707, subfamily A, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166439 CPD "CONSTITUTIVE PHOTOMORPHOGENIC DWARF" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091571 CYP90D1 ""cytochrome P450, family 90, subfamily D, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2134781 CYP707A1 ""cytochrome P450, family 707, subfamily A, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6F4F5 CYP724B1 "Cytochrome P450 724B1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2115220 ROT3 "ROTUNDIFOLIA 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158961 CYP716A1 ""cytochrome P450, family 716, subfamily A, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.14.15.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
KAO2
KAO2 (ENT-KAURENOIC ACID HYDROXYLASE 2); ent-kaurenoate oxidase/ oxygen binding; ent-kaurenoic acid hydroxylase (KAO2) ; Catalyzes three successive oxidations of ent-kaurenoic acid giving gibberellin 12 (GA12), a key step in gibberellins (GAs) biosynthesis. GAs, which are involved many processes, including stem elongation, play a central role in plant development (489 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
GA20OX3
YAP169; gibberellin 20-oxidase; encodes a gibberellin 20-oxidase. ; Key oxidase enzyme in the b [...] (380 aa)
      0.940
GA20OX1
GA20OX1; gibberellin 20-oxidase; Encodes gibberellin 20-oxidase that is involved in the later s [...] (377 aa)
      0.937
GA20OX2
GA20OX2 (GIBBERELLIN 20 OXIDASE 2); gibberellin 20-oxidase; Encodes gibberellin 20-oxidase. Inv [...] (378 aa)
      0.936
ATGA20OX4
ATGA20OX4 (ARABIDOPSIS THALIANA GIBBERELLIN 20-OXIDASE 4); gibberellin 20-oxidase; ARABIDOPSIS [...] (376 aa)
       0.899
GA2
GA2 (GA REQUIRING 2); ent-kaurene synthase; Encodes for a protein with ent-kaurene synthase B a [...] (785 aa)
       0.677
GA3OX1
GA3OX1 (GIBBERELLIN 3-OXIDASE 1); gibberellin 3-beta-dioxygenase/ transcription factor binding; [...] (358 aa)
       0.619
ATGA2OX2
ATGA2OX2 (GIBBERELLIN 2-OXIDASE); gibberellin 2-beta-dioxygenase; Encodes a gibberellin 2-oxida [...] (341 aa)
       0.561
ENT7
equilibrative nucleoside transporter, putative (ENT7); equilibrative nucleoside transporter, pu [...] (417 aa)
       0.534
GA2OX8
GA2OX8 (GIBBERELLIN 2-OXIDASE 8); gibberellin 2-beta-dioxygenase; Encodes a protein with gibber [...] (338 aa)
       0.501
ATGA2OX3
ATGA2OX3 (gibberellin 2-oxidase 3); gibberellin 2-beta-dioxygenase; gibberellin 2-oxidase 3 (AT [...] (335 aa)
       0.466

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query343
PLN02302 490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 8e-92
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 2e-51
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 1e-32
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 1e-27
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 1e-25
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 7e-25
pfam00067461 pfam00067, p450, Cytochrome P450 4e-24
PLN03141 452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 1e-21
PLN02987 472 PLN02987, PLN02987, Cytochrome P450, family 90, su 5e-21
PLN02196 463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 1e-20
PLN02500 490 PLN02500, PLN02500, cytochrome P450 90B1 6e-20
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 3e-19
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 5e-19
PLN02774 463 PLN02774, PLN02774, brassinosteroid-6-oxidase 1e-17
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 5e-13
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 6e-12
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 2e-10
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 2e-10
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 1e-09
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 1e-09
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 4e-09
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 2e-08
pfam00067 461 pfam00067, p450, Cytochrome P450 1e-06
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 1e-06
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 1e-06
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 4e-06
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 1e-05
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 5e-05
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 3e-04
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 0.001
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 0.002
PLN02648 480 PLN02648, PLN02648, allene oxide synthase 0.002
PLN02971 543 PLN02971, PLN02971, tryptophan N-hydroxylase 0.003
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
 Score =  282 bits (723), Expect = 8e-92
 Identities = 106/240 (44%), Positives = 156/240 (65%), Gaps = 3/240 (1%)

Query: 1   MELDLLWLILAIAAGSYIIVYAFVRRVNEWYHVSKLGEKRHFLPPGDMGWPFLGNMPSFL 60
           MEL  +W+ LA       ++   +RRVN W +  KLGE +  LPPGD+GWP +GNM SFL
Sbjct: 1   MELGSIWVWLAAIVAGVFVLKWVLRRVNSWLYEPKLGEGQPPLPPGDLGWPVIGNMWSFL 60

Query: 61  RAYRSNNPETFIDSIVERYGRTGVYKTHLFGNPSIIVSSPQTCRRVLMDDEKFGLGYGKS 120
           RA++S+NP++FI S + RYGRTG+YK  +FG P+++V++P+ C+RVL DD+ F  G+ +S
Sbjct: 61  RAFKSSNPDSFIASFISRYGRTGIYKAFMFGQPTVLVTTPEACKRVLTDDDAFEPGWPES 120

Query: 121 MTRLAGKNTFVNIAKSEHRRLRKMMTSLMISHEALVMYIGNTEDVAIASLEEWAAASKDE 180
              L G+ +FV I   EH+RLR++  + +   EAL  YI   E+   + LE+W+   +  
Sbjct: 121 TVELIGRKSFVGITGEEHKRLRRLTAAPVNGPEALSTYIPYIEENVKSCLEKWSKMGE-- 178

Query: 181 PIEFFCETSKLSLKFIMRILFGSTSDSIFSSVEKHYIDVHDGVHSTAINLPGFAFHKALK 240
            IEF  E  KL+ K IM I   S S+ +  ++E+ Y  ++ GV + AINLPGFA+H+ALK
Sbjct: 179 -IEFLTELRKLTFKIIMYIFLSSESELVMEALEREYTTLNYGVRAMAINLPGFAYHRALK 237


Length = 490

>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|215350 PLN02648, PLN02648, allene oxide synthase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 343
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 100.0
PLN02648480 allene oxide synthase 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 100.0
PHA0304968 IMV membrane protein; Provisional 83.03
PF15050133 SCIMP: SCIMP protein 80.99
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
Probab=100.00  E-value=7.6e-59  Score=415.59  Aligned_cols=300  Identities=27%  Similarity=0.405  Sum_probs=246.2

Q ss_pred             ccCCCCCCCCcCCcccccchHHHhhhcCCChHHHHHHHHHhhCCCcEEEEeecCCCEEEEeChHHHHHHhcCCc-ccccc
Q 019285           38 EKRHFLPPGDMGWPFLGNMPSFLRAYRSNNPETFIDSIVERYGRTGVYKTHLFGNPSIIVSSPQTCRRVLMDDE-KFGLG  116 (343)
Q Consensus        38 ~~~~~~Ppgp~~~P~lG~~~~~~~~~~~~~~~~~~~~~~~~yg~~~v~~~~~~~~~~vvi~~~~~~~~vl~~~~-~~~~~  116 (343)
                      +++.++||||++||++||++++..    ..+|+.+.+|.++||+  ++++|+|..++|||+|+++++|++.+++ .|+.+
T Consensus        22 ~~~~~lPPGP~~lPiIGnl~~l~~----~~~h~~~~~ls~~yGp--i~tl~lG~~~~Vviss~~~akE~l~~~d~~fa~R   95 (489)
T KOG0156|consen   22 RKRRNLPPGPPPLPIIGNLHQLGS----LPPHRSFRKLSKKYGP--VFTLRLGSVPVVVISSYEAAKEVLVKQDLEFADR   95 (489)
T ss_pred             cCCCCCCcCCCCCCccccHHHcCC----CchhHHHHHHHHHhCC--eEEEEecCceEEEECCHHHHHHHHHhCCccccCC
Confidence            334899999999999999999985    2599999999999999  9999999999999999999999999998 66655


Q ss_pred             cc-hhh-hhhc-CCcceecC-CCchHHHHHHhhhhcCCCHHHHHhhHHHHHHHHHHHHHHHhhhcCCCceehHHHHHHHH
Q 019285          117 YG-KSM-TRLA-GKNTFVNI-AKSEHRRLRKMMTSLMISHEALVMYIGNTEDVAIASLEEWAAASKDEPIEFFCETSKLS  192 (343)
Q Consensus       117 ~~-~~~-~~~~-g~~~~~~~-~~~~w~~~R~~~~~~~f~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~vdl~~~~~~~~  192 (343)
                      .. ... ..+. |..++.++ +|+.|+++||+...++++...+++......++++.+++.+.....+..||+...+..++
T Consensus        96 p~~~~~~~~~~~~~~~i~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~~~R~~E~~~l~~~l~~~~~~~~vdl~~~l~~~~  175 (489)
T KOG0156|consen   96 PDPTATLKYLSYGGKGIVFAPYGDYWREMRRFALTELRSFGRGKSFMEIREEEVDELVKKLSKSKKGEPVDLSELLDLLV  175 (489)
T ss_pred             CCchhhHHHhcCCCCceEeCCCcHHHHHHHHHHHHHhcChhhhhhhHHHHHHHHHHHHHHHHhcCCCceeeHHHHHHHHH
Confidence            43 123 3333 55778776 89999999999999899999999998888999999999987522227899999999999


Q ss_pred             HHHHHHHHcCCCCchhH----HHHHHHHHHHhccc--cccccCCC-chh-------------------------------
Q 019285          193 LKFIMRILFGSTSDSIF----SSVEKHYIDVHDGV--HSTAINLP-GFA-------------------------------  234 (343)
Q Consensus       193 ~~~~~~~~fG~~~~~~~----~~~~~~~~~~~~~~--~~~~~~~~-~~~-------------------------------  234 (343)
                      .++++.++||.+.....    .++.+.+.+..+..  ......+| ...                               
T Consensus       176 ~nvI~~~~fG~rf~~~~~~~~~~~~~l~~~~~~~~~~~~~~d~~p~~l~~~~~~~g~~~~~~~~~~~~~~~~~~~i~eh~  255 (489)
T KOG0156|consen  176 GNVICRMLFGRRFEEEDEEEFLELKELVEESLELLGSFNLSDYFPFLLRWLDGISGLEKRLKKVSKRLDEFLERIIDEHR  255 (489)
T ss_pred             HHHHHHHHhCCccccCCchHHHHHHHHHHHHHHHhCCccHHHHhhHHHHhcccccHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999975421    22333333322211  11111111 000                               


Q ss_pred             ----------HHHHHH----------------------------------------------------------------
Q 019285          235 ----------FHKALK----------------------------------------------------------------  240 (343)
Q Consensus       235 ----------~~~~~~----------------------------------------------------------------  240 (343)
                                +...+-                                                                
T Consensus       256 ~~~~~~~~~D~vD~lL~~~~~~~~~~~t~~~i~~~~~dl~~AGtdTta~Tl~Wa~a~Ll~~Pev~~K~qeEId~vvG~~r  335 (489)
T KOG0156|consen  256 EKIGDEEGRDFVDALLKLMKEEKAEGLTDDHLKALILDLFLAGTDTTATTLEWAMAELLNNPEVQKKLQEEIDEVVGKGR  335 (489)
T ss_pred             hhhccCCCCcHHHHHHHhhcccccCCCCHHHHHHHHHHHHhcccchHHHHHHHHHHHHHhCHHHHHHHHHHHHHHhCCCC
Confidence                      000000                                                                


Q ss_pred             ---------------HHHhhhccccCCc-cccccccCCceecCEEeCCCCEEEeechhhhcCCCCCCCCCCCCCCCCCCC
Q 019285          241 ---------------VIDETLRLMNLPF-LDFREAKTDANIKGYTIPKGWKVLIWNRAVHMDPENFSAPKEFDPSRWDNN  304 (343)
Q Consensus       241 ---------------~i~E~lRl~p~~~-~~~R~~~~d~~l~g~~ip~g~~v~~~~~~~~~d~~~~~~p~~F~peRfl~~  304 (343)
                                     +|+|++|++|++| .++|.+++|+.++||.||+||.|+++.+++||||++|+||++|+||||+++
T Consensus       336 ~v~e~D~~~lpYL~Avi~E~~Rl~p~~Pl~~ph~~~~d~~i~Gy~IPkgT~v~vn~~ai~rDp~vw~dP~eF~PERFl~~  415 (489)
T KOG0156|consen  336 LVSESDLPKLPYLKAVIKETLRLHPPLPLLLPRETTEDTKIGGYDIPKGTTVLVNLWAIHRDPKVWEDPEEFKPERFLDS  415 (489)
T ss_pred             CCChhhhccCHHHHHHHHHHHhcCCCccccccccccCCeeEcCEEcCCCCEEEEeehhhhcCCccCCCccccChhhhcCC
Confidence                           9999999999999 789999999999999999999999999999999999999999999999996


Q ss_pred             C---CCCCCcccCCCCCCCCccHHHHHHHHHHHHHHHHhhCC
Q 019285          305 A---AEPGSFIPFGGGSRRCLGIDVAKIEVSIFLHYFLLNYK  343 (343)
Q Consensus       305 ~---~~~~~~~~Fg~G~r~C~G~~~a~~~~~~~l~~ll~~f~  343 (343)
                      +   .....++|||.|+|.|||..+|.+++.++++.||++||
T Consensus       416 ~d~~~~~~~~iPFG~GRR~CpG~~La~~~l~l~la~llq~F~  457 (489)
T KOG0156|consen  416 NDGKGLDFKLIPFGSGRRICPGEGLARAELFLFLANLLQRFD  457 (489)
T ss_pred             ccccCCceEecCCCCCcCCCCcHHHHHHHHHHHHHHHHheee
Confidence            2   46778999999999999999999999999999999996



>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PHA03049 IMV membrane protein; Provisional Back     alignment and domain information
>PF15050 SCIMP: SCIMP protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query343
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 2e-13
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 5e-12
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 5e-12
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 5e-12
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 9e-11
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 2e-10
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 2e-10
3mgx_A415 Crystal Structure Of P450 Oxyd That Is Involved In 6e-09
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 6e-09
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 1e-08
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 1e-08
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 1e-08
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 1e-08
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 1e-08
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 1e-08
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 2e-08
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 2e-08
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 2e-08
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 2e-08
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 2e-08
3r9c_A418 Crystal Structure Of Mycobacterium Smegmatis Cyp164 2e-08
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 3e-08
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 3e-08
3tkt_A450 Crystal Structure Of Cyp108d1 From Novosphingobium 3e-08
1cpt_A428 Crystal Structure And Refinement Of Cytochrome P450 5e-08
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 7e-08
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 8e-08
1ue8_A367 Crystal Structure Of Thermophilic Cytochrome P450 F 1e-07
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 1e-07
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 1e-07
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 2e-07
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 2e-07
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 3e-07
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 4e-07
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 6e-07
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 6e-07
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 6e-07
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 7e-07
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 8e-07
3ejb_B404 Crystal Structure Of P450bioi In Complex With Tetra 8e-07
3tyw_A417 Crystal Structure Of Cyp105n1 From Streptomyces Coe 1e-06
3p3l_A406 Crystal Structure Of The Cytochrome P450 Monooxygen 2e-06
3p3o_A416 Crystal Structure Of The Cytochrome P450 Monooxygen 2e-06
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 2e-06
3k1o_A458 Crystal Structure Of Sterol 14-alpha Demethylase (c 6e-06
3khm_A464 Crystal Structure Of Sterol 14alpha-Demethylase (Cy 6e-06
2wuz_A473 X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In 6e-06
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 7e-06
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 7e-06
1jip_A403 P450eryf(A245s)KETOCONAZOLE Length = 403 9e-06
1z8p_A404 Ferrous Dioxygen Complex Of The A245s Cytochrome P4 9e-06
1z8q_A404 Ferrous Dioxygen Complex Of The A245t Cytochrome P4 9e-06
1jio_A403 P450eryf/6deb Length = 403 9e-06
1z8o_A404 Ferrous Dioxygen Complex Of The Wild-Type Cytochrom 9e-06
3gw9_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 1e-05
3g1q_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 1e-05
2wv2_A475 X-Ray Structure Of Cyp51 From The Human Pathogen Tr 1e-05
3tik_A454 Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom 1e-05
3p99_A453 Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma 1e-05
2x2n_A475 X-Ray Structure Of Cyp51 From Trypanosoma Brucei In 1e-05
1egy_A403 Cytochrome P450eryf With 9-Aminophenanthrene Bound 1e-05
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 1e-05
3ofu_A396 Crystal Structure Of Cytochrome P450 Cyp101c1 Lengt 1e-05
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 1e-05
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 2e-05
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 2e-05
3aba_A403 Crystal Structure Of Cyp105p1 In Complex With Filip 2e-05
3e5j_A403 Crystal Structure Of Cyp105p1 Wild-type Ligand-free 2e-05
3e5l_A403 Crystal Structure Of Cyp105p1 H72a Mutant Length = 2e-05
1f4t_A368 Thermophilic P450: Cyp119 From Sulfolobus Solfactar 4e-05
1io8_A368 Thermophilic Cytochrome P450 (Cyp119) From Sulfolob 4e-05
2vrv_A431 Structure Of Histidine Tagged Cytochrome P450 Eryk 4e-05
2jjn_A411 Structure Of Closed Cytochrome P450 Eryk Length = 4 4e-05
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 5e-05
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 5e-05
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 5e-05
2rfb_A343 Crystal Structure Of A Cytochrome P450 From The The 6e-05
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 7e-05
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 7e-05
3pm0_A507 Structural Characterization Of The Complex Between 9e-05
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 1e-04
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 1e-04
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 1e-04
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 1e-04
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 1e-04
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 1e-04
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 1e-04
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 1e-04
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 1e-04
1fah_A471 Structure Of Cytochrome P450 Length = 471 1e-04
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 1e-04
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 1e-04
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 1e-04
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 1e-04
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 1e-04
3rwl_A426 Structure Of P450pyr Hydroxylase Length = 426 1e-04
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 1e-04
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 1e-04
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 1e-04
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 1e-04
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 1e-04
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 1e-04
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-04
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 1e-04
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 1e-04
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 1e-04
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 1e-04
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 1e-04
3l4d_A453 Crystal Structure Of Sterol 14-Alpha Demethylase (C 1e-04
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 1e-04
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 2e-04
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 2e-04
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 2e-04
3abb_A408 Crystal Structure Of Cyp105d6 Length = 408 2e-04
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 3e-04
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 4e-04
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 4e-04
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 5e-04
1lfk_A398 Crystal Structure Of Oxyb, A Cytochrome P450 Implic 7e-04
2fr7_A412 Crystal Structure Of Cytochrome P450 Cyp199a2 Lengt 7e-04
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 8e-04
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure

Iteration: 1

Score = 73.6 bits (179), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 36/99 (36%), Positives = 55/99 (55%), Gaps = 4/99 (4%) Query: 240 KVIDETLRLMNLPFLDFREAKTDANIKGYTIPKGWKVLIWNRAVHMDPENFSAPKEFDPS 299 +V+ E LRL+ FRE D +G+ PKGW V H DP+ + P++FDP Sbjct: 306 QVLQEVLRLIPPVGGGFRELIQDCQFQGFHFPKGWLVSYQISQTHADPDLYPDPEKFDPE 365 Query: 300 RWDNNAA----EPGSFIPFGGGSRRCLGIDVAKIEVSIF 334 R+ + + P + +PFGGG R CLG + A++E+ +F Sbjct: 366 RFTPDGSATHNPPFAHVPFGGGLRECLGKEFARLEMKLF 404
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3MGX|A Chain A, Crystal Structure Of P450 Oxyd That Is Involved In The Biosynthesis Of Vancomycin-Type Antibiotics Length = 415 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|3R9C|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Cyp164a2 With Econazole Bound Length = 418 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|3TKT|A Chain A, Crystal Structure Of Cyp108d1 From Novosphingobium Aromaticivorans Dsm12444 Length = 450 Back     alignment and structure
>pdb|1CPT|A Chain A, Crystal Structure And Refinement Of Cytochrome P450-Terp At 2.3 Angstroms Resolution Length = 428 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|1UE8|A Chain A, Crystal Structure Of Thermophilic Cytochrome P450 From Sulfolobus Tokodaii Length = 367 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|3EJB|B Chain B, Crystal Structure Of P450bioi In Complex With Tetradecanoic Acid Ligated Acyl Carrier Protein Length = 404 Back     alignment and structure
>pdb|3TYW|A Chain A, Crystal Structure Of Cyp105n1 From Streptomyces Coelicolor A3(2) Length = 417 Back     alignment and structure
>pdb|3P3L|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Wildtype) From Streptomyces Thioluteus Length = 406 Back     alignment and structure
>pdb|3P3O|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Ntermii) From Streptomyces Thioluteus Length = 416 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 Back     alignment and structure
>pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 Back     alignment and structure
>pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|1JIP|A Chain A, P450eryf(A245s)KETOCONAZOLE Length = 403 Back     alignment and structure
>pdb|1Z8P|A Chain A, Ferrous Dioxygen Complex Of The A245s Cytochrome P450eryf Length = 404 Back     alignment and structure
>pdb|1Z8Q|A Chain A, Ferrous Dioxygen Complex Of The A245t Cytochrome P450eryf Length = 404 Back     alignment and structure
>pdb|1JIO|A Chain A, P450eryf/6deb Length = 403 Back     alignment and structure
>pdb|1Z8O|A Chain A, Ferrous Dioxygen Complex Of The Wild-Type Cytochrome P450eryf Length = 404 Back     alignment and structure
>pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 Back     alignment and structure
>pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 Back     alignment and structure
>pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 Back     alignment and structure
>pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 Back     alignment and structure
>pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 Back     alignment and structure
>pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 Back     alignment and structure
>pdb|1EGY|A Chain A, Cytochrome P450eryf With 9-Aminophenanthrene Bound Length = 403 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|3OFU|A Chain A, Crystal Structure Of Cytochrome P450 Cyp101c1 Length = 396 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|3ABA|A Chain A, Crystal Structure Of Cyp105p1 In Complex With Filipin I Length = 403 Back     alignment and structure
>pdb|3E5J|A Chain A, Crystal Structure Of Cyp105p1 Wild-type Ligand-free Form Length = 403 Back     alignment and structure
>pdb|3E5L|A Chain A, Crystal Structure Of Cyp105p1 H72a Mutant Length = 403 Back     alignment and structure
>pdb|1F4T|A Chain A, Thermophilic P450: Cyp119 From Sulfolobus Solfactaricus With 4- Phenylimidazole Bound Length = 368 Back     alignment and structure
>pdb|1IO8|A Chain A, Thermophilic Cytochrome P450 (Cyp119) From Sulfolobus Solfataricus: High Resolution Structural Origin Of Its Thermostability And Functional Properties Length = 368 Back     alignment and structure
>pdb|2VRV|A Chain A, Structure Of Histidine Tagged Cytochrome P450 Eryk In Complex With Inhibitor Clotrimazole (Clt) Length = 431 Back     alignment and structure
>pdb|2JJN|A Chain A, Structure Of Closed Cytochrome P450 Eryk Length = 411 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|2RFB|A Chain A, Crystal Structure Of A Cytochrome P450 From The Thermoacidophilic Archaeon Picrophilus Torridus Length = 343 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|3RWL|A Chain A, Structure Of P450pyr Hydroxylase Length = 426 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Leishmania Infantum In Complex With Fluconazole Length = 453 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|3ABB|A Chain A, Crystal Structure Of Cyp105d6 Length = 408 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1LFK|A Chain A, Crystal Structure Of Oxyb, A Cytochrome P450 Implicated In An Oxidative Phenol Coupling Reaction During Vancomycin Biosynthesis Length = 398 Back     alignment and structure
>pdb|2FR7|A Chain A, Crystal Structure Of Cytochrome P450 Cyp199a2 Length = 412 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query343
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 1e-47
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 2e-42
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 3e-34
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 1e-25
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 8e-34
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 7e-28
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 1e-30
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 6e-28
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 6e-29
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 2e-25
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 8e-29
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 2e-22
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 1e-28
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 6e-19
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 5e-28
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 3e-19
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 6e-25
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 2e-16
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 4e-24
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 2e-20
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 9e-24
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-13
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 2e-22
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 4e-08
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 7e-22
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 4e-13
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 2e-21
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 4e-20
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 6e-05
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 4e-20
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 6e-20
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 4e-05
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 6e-20
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 5e-06
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 1e-19
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 1e-06
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-19
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 7e-05
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 2e-19
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 1e-05
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 5e-19
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 2e-06
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-18
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 7e-06
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 2e-18
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 1e-11
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 4e-18
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 3e-08
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 8e-18
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 1e-05
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 1e-17
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 4e-12
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 2e-17
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 9e-10
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 8e-17
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 4e-14
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 2e-11
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 2e-11
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 3e-11
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 4e-11
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 4e-11
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 5e-11
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 6e-11
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 7e-11
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 8e-11
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 1e-10
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 1e-10
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 2e-10
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 2e-10
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 3e-10
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 6e-10
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 1e-09
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 1e-09
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 1e-09
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 2e-09
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 2e-09
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 2e-09
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 3e-09
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 3e-09
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 3e-09
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 3e-09
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 4e-09
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 7e-09
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 7e-09
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 8e-09
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 8e-09
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 9e-09
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 1e-08
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 1e-08
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 1e-08
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 1e-08
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 1e-08
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 1e-08
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 1e-08
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 2e-08
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 2e-08
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 2e-08
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 2e-08
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 3e-08
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 3e-08
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 9e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 1e-05
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
 Score =  165 bits (420), Expect = 1e-47
 Identities = 44/211 (20%), Positives = 80/211 (37%), Gaps = 17/211 (8%)

Query: 43  LPPGDMGWPFLGNMPSFLRAYRSNNPETFIDSIVERYGRTGVYKTHLFGNPSIIVSSPQT 102
           +PPGD G P+LG   +FL          F     +++G   ++KT LFG   I +S    
Sbjct: 13  IPPGDFGLPWLGETLNFLN------DGDFGKKRQQQFGP--IFKTRLFGKNVIFISGALA 64

Query: 103 CRRVLMDDEK-FGLGYGKSMTRLAGKNTFVNIAKSEHRRLRKMMTSLMISHEALVMYIGN 161
            R +   +++ F   +  S   L G N         HR  RK++         L  Y+  
Sbjct: 65  NRFLFTKEQETFQATWPLSTRILLGPNALATQMGEIHRSRRKILYQAF-LPRTLDSYLPK 123

Query: 162 TEDVAIASLEEWAAASKDEPIEFFCETSKLSLKFIMRILFGSTSDSIFSSVEKHYIDVHD 221
            + +    LE+W    K   + ++ +  +++      +  G         +   +     
Sbjct: 124 MDGIVQGYLEQWG---KANEVIWYPQLRRMTFDVAATLFMGEKVSQN-PQLFPWFETYIQ 179

Query: 222 GVHSTAINLPGFAFHKALK---VIDETLRLM 249
           G+ S  I LP   F K+ +   ++   L  +
Sbjct: 180 GLFSLPIPLPNTLFGKSQRARALLLAELEKI 210


>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query343
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 100.0
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 100.0
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 100.0
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 100.0
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=1.6e-55  Score=403.74  Aligned_cols=298  Identities=21%  Similarity=0.291  Sum_probs=223.5

Q ss_pred             ccCCCCCCCCcCCcccccchHHHhhhcCCChHHHHHHHHHhhCCCcEEEEeecCCCEEEEeChHHHHHHhcCCc-ccccc
Q 019285           38 EKRHFLPPGDMGWPFLGNMPSFLRAYRSNNPETFIDSIVERYGRTGVYKTHLFGNPSIIVSSPQTCRRVLMDDE-KFGLG  116 (343)
Q Consensus        38 ~~~~~~Ppgp~~~P~lG~~~~~~~~~~~~~~~~~~~~~~~~yg~~~v~~~~~~~~~~vvi~~~~~~~~vl~~~~-~~~~~  116 (343)
                      ++++++||||++||++||++++.    .++++..+.+|++|||+  ||++++|+.++|+|+||+++++|+.+++ .|...
T Consensus         6 ss~~kLPPGP~~lP~iGn~~~~~----~~~~~~~~~~~~~kYG~--i~~~~~g~~~~vvv~~p~~i~~vl~~~~~~f~~r   79 (479)
T 3tbg_A            6 SSKGKLPPGPLPLPGLGNLLHVD----FQNTPYCFDQLRRRFGD--VFSLQLAWTPVVVLNGLAAVREALVTHGEDTADR   79 (479)
T ss_dssp             ---CCCCCCSCCBTTTBTGGGCC----TTSHHHHHHHHHHHHCS--EEEEEETTEEEEEEEHHHHHHHHHTTTGGGSCBC
T ss_pred             CCCCCCCCCCCCcCcccchHhhc----CCCHHHHHHHHHHHhCC--EEEEEECCeeEEEECCHHHHHHHHHhCChhhcCC
Confidence            56678999999999999999886    34789999999999999  9999999999999999999999998876 55544


Q ss_pred             cchhhhhhcC----Ccc-eecCCCchHHHHHHhhhhcCCCHHHHHh--hHHHHHHHHHHHHHHHhhhcCCCceehHHHHH
Q 019285          117 YGKSMTRLAG----KNT-FVNIAKSEHRRLRKMMTSLMISHEALVM--YIGNTEDVAIASLEEWAAASKDEPIEFFCETS  189 (343)
Q Consensus       117 ~~~~~~~~~g----~~~-~~~~~~~~w~~~R~~~~~~~f~~~~l~~--~~~~~~~~~~~~~~~~~~~~~~~~vdl~~~~~  189 (343)
                      ........++    ..+ ++..+|+.|+++|+++.+ .|+...+..  +...+......+...+.. ..+..+|+...+.
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~g~~w~~~R~~~~~-~~~~~~~~~~~~~~~~~~~~~~l~~~~~~-~~~~~~~~~~~~~  157 (479)
T 3tbg_A           80 PPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVS-TLRNLGLGKKSLEQWVTEEAACLCAAFAN-HSGRPFRPNGLLD  157 (479)
T ss_dssp             CCCGGGGGGTCBTTBCCSTTCCSSHHHHHHHHHHHH-HHHHTTSTTCHHHHHHHHHHHHHHHHHHT-TTTCCBCTHHHHH
T ss_pred             CchHHHHHhccCCCCCceeeCCCCHHHHHHHHHHHH-HhcchhhhHHHHHHHHHHHHHHHHHHHHh-ccCCcccHHHHHH
Confidence            3333333321    123 344679999999999999 776665543  334444444444444443 3466799999999


Q ss_pred             HHHHHHHHHHHcCCCCchhHHHHHHHHHHH---hccccc--------cccCCCchhHHHH----HH--------------
Q 019285          190 KLSLKFIMRILFGSTSDSIFSSVEKHYIDV---HDGVHS--------TAINLPGFAFHKA----LK--------------  240 (343)
Q Consensus       190 ~~~~~~~~~~~fG~~~~~~~~~~~~~~~~~---~~~~~~--------~~~~~~~~~~~~~----~~--------------  240 (343)
                      .+++++++.++||.+......+........   ......        .+...........    .+              
T Consensus       158 ~~~~~~~~~~~fg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  237 (479)
T 3tbg_A          158 KAVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHR  237 (479)
T ss_dssp             HHHHHHHHHHHHSCCCCTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHSGGGGGSHHHHHHHTHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHhhcCCcccccchhhhhhhhhhhhhhhhhhhhhhhhhcccchhccchhhHHHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999998643322222211111   110000        0000000000000    00              


Q ss_pred             --------------------------------------------------------------------------------
Q 019285          241 --------------------------------------------------------------------------------  240 (343)
Q Consensus       241 --------------------------------------------------------------------------------  240 (343)
                                                                                                      
T Consensus       238 ~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~l~~~~i~~~~~~~~~AG~dTta~~l~~~l~~L~~~P~~q~kl~~Ei~~~~  317 (479)
T 3tbg_A          238 MTWDPAQPPRDLTEAFLAEMEKAKGNPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVI  317 (479)
T ss_dssp             HHCCTTSCCCSHHHHHHHHHHHTTTCTTCSCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHT
T ss_pred             HhhhcccccchhhhhhhhhhhhcccCCccchhhHHHHHHHHHHHHhhhhhhHHHHHHHHHHhccCHHHHHHHHHHHHHHH
Confidence                                                                                            


Q ss_pred             -------------------HHHhhhccccCCcc-ccccccCCceecCEEeCCCCEEEeechhhhcCCCCCCCCCCCCCCC
Q 019285          241 -------------------VIDETLRLMNLPFL-DFREAKTDANIKGYTIPKGWKVLIWNRAVHMDPENFSAPKEFDPSR  300 (343)
Q Consensus       241 -------------------~i~E~lRl~p~~~~-~~R~~~~d~~l~g~~ip~g~~v~~~~~~~~~d~~~~~~p~~F~peR  300 (343)
                                         ||+||||++|++|. ..|.+.+|++++||.||+|+.|+++.+++||||++|+||++|+|||
T Consensus       318 ~~~~~~~~~~l~~lpyl~avi~EtlRl~p~~~~~~~~~~~~d~~~~g~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeR  397 (479)
T 3tbg_A          318 GQVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEH  397 (479)
T ss_dssp             CSSSCCCHHHHTTCHHHHHHHHHHHHHHCSSTTCCCEECSSCEEETTEEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGG
T ss_pred             hhccccchhhhccccccccceeeeccccccccccceeecCCCceECCEEecCCCeeeechhhhcCChhhCCCccccCccc
Confidence                               99999999999994 5556789999999999999999999999999999999999999999


Q ss_pred             CCCCC---CCCCCcccCCCCCCCCccHHHHHHHHHHHHHHHHhhCC
Q 019285          301 WDNNA---AEPGSFIPFGGGSRRCLGIDVAKIEVSIFLHYFLLNYK  343 (343)
Q Consensus       301 fl~~~---~~~~~~~~Fg~G~r~C~G~~~a~~~~~~~l~~ll~~f~  343 (343)
                      |++++   ..+..|+|||+|+|.|||++||++|++++++.||++||
T Consensus       398 fl~~~~~~~~~~~~~pFG~G~R~C~G~~lA~~e~~~~la~ll~~f~  443 (479)
T 3tbg_A          398 FLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFS  443 (479)
T ss_dssp             GBCTTCCBCCCTTCCTTCCSTTSCTTHHHHHHHHHHHHHHHHHHEE
T ss_pred             cCCCCcccCCCCceecCCCCCcCChhHHHHHHHHHHHHHHHHHccE
Confidence            99766   56778999999999999999999999999999999996



>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 343
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 6e-22
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 2e-14
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 3e-20
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 3e-15
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 2e-18
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 5e-16
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 4e-17
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 4e-16
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 4e-13
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 1e-15
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 2e-13
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 2e-15
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 4e-15
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 1e-14
d1odoa_ 401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 0.001
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 1e-14
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 1e-13
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 2e-14
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 6e-14
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 1e-13
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 1e-13
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 5e-13
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 2e-13
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 2e-12
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 4e-12
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 3e-11
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 5e-11
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 1e-10
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 3e-10
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 8e-07
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 94.0 bits (232), Expect = 6e-22
 Identities = 36/105 (34%), Positives = 56/105 (53%), Gaps = 3/105 (2%)

Query: 242 IDETLRLMNLPFLDFREAKTDANIKGYTIPKGWKVLIWNRAVHMDPENFSAPKEFDPSRW 301
           ++ETLRL  +     R  K D  I G  IPKG  V+I + A+H DP+ ++ P++F P R+
Sbjct: 333 VNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERF 392

Query: 302 DNNAAE---PGSFIPFGGGSRRCLGIDVAKIEVSIFLHYFLLNYK 343
                +   P  + PFG G R C+G+  A + + + L   L N+ 
Sbjct: 393 SKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFS 437


>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query343
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 100.0
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 100.0
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 100.0
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 100.0
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 100.0
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 100.0
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 100.0
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 100.0
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.6e-55  Score=400.59  Aligned_cols=290  Identities=23%  Similarity=0.360  Sum_probs=235.4

Q ss_pred             CCCcCCcccccchHHHhhhcCCChHHHHHHHHHhhCCCcEEEEeecCCCEEEEeChHHHHHHhcCCc-ccccccchh-hh
Q 019285           45 PGDMGWPFLGNMPSFLRAYRSNNPETFIDSIVERYGRTGVYKTHLFGNPSIIVSSPQTCRRVLMDDE-KFGLGYGKS-MT  122 (343)
Q Consensus        45 pgp~~~P~lG~~~~~~~~~~~~~~~~~~~~~~~~yg~~~v~~~~~~~~~~vvi~~~~~~~~vl~~~~-~~~~~~~~~-~~  122 (343)
                      |||+++|++||++++.+     +++.++.+|+++||+  ||++++++.++|+|+||+++++++.++. .+...+... ..
T Consensus        12 PGP~~~P~iG~~~~~~~-----~~~~~~~~~~~kyG~--i~~~~l~~~~~vvv~~p~~~~~il~~~~~~~~~~~~~~~~~   84 (472)
T d1tqna_          12 PGPTPLPFLGNILSYHK-----GFCMFDMECHKKYGK--VWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPV   84 (472)
T ss_dssp             CCCCCBTTTBTGGGGGG-----CHHHHHHHHHHHHCS--EEEEEETTEEEEEECCHHHHHHHHTTTTTTTCCBCCCCSCC
T ss_pred             CCCCCcCceeEHHHhhC-----CHHHHHHHHHHHhCC--EEEEEECCeeEEEECCHHHHHHHHhcCCcccccCCcccccc
Confidence            89999999999999976     899999999999999  9999999999999999999999998775 344333322 23


Q ss_pred             hhcCCcceecCCCchHHHHHHhhhhcCCCHHHHHhhHHHHHHHHHHHHHHHhhh-cCCCceehHHHHHHHHHHHHHHHHc
Q 019285          123 RLAGKNTFVNIAKSEHRRLRKMMTSLMISHEALVMYIGNTEDVAIASLEEWAAA-SKDEPIEFFCETSKLSLKFIMRILF  201 (343)
Q Consensus       123 ~~~g~~~~~~~~~~~w~~~R~~~~~~~f~~~~l~~~~~~~~~~~~~~~~~~~~~-~~~~~vdl~~~~~~~~~~~~~~~~f  201 (343)
                      ...+ +++++++|+.|+++|+++++ .|+.+.+..+.+.+.+.++.+++.|.+. ..+..+|+.+.+.++++++++.++|
T Consensus        85 ~~~~-~~i~~~~g~~~~~~R~~~~~-~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~dl~~~~~~~~~~v~~~~~~  162 (472)
T d1tqna_          85 GFMK-SAISIAEDEEWKRLRSLLSP-TFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSF  162 (472)
T ss_dssp             GGGG-GSTTTCCHHHHHHHHHHTTG-GGSHHHHHTTHHHHHHHHHHHHHHHHHHHHHSSCEEHHHHHHHHHHHHHHHTSS
T ss_pred             cccC-CceeccCcHHHHHhhhhcCc-cccchhhhcccchhhhhhhcccccccccccccccchhhhhhhccchhhhhheec
Confidence            3333 78888999999999999999 9999999999999999999999987643 3367899999999999999999999


Q ss_pred             CCCCchhHHH---HHHHHHHHhccccc---------cccCCCc----------hhHHHHHH-------------------
Q 019285          202 GSTSDSIFSS---VEKHYIDVHDGVHS---------TAINLPG----------FAFHKALK-------------------  240 (343)
Q Consensus       202 G~~~~~~~~~---~~~~~~~~~~~~~~---------~~~~~~~----------~~~~~~~~-------------------  240 (343)
                      |.+.+.....   +......+......         .+...+.          ......+.                   
T Consensus       163 G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  242 (472)
T d1tqna_         163 GVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRV  242 (472)
T ss_dssp             CCCCCGGGCTTCHHHHHHTTCCCCCTTSHHHHHHHHCGGGHHHHHHTTCCSSCHHHHHHHHHHHHHHHTTTTTTCSCCCC
T ss_pred             ccccccccccchhhhHHHHHHhhhhhccchhcccccccccccccccccccccchhhhHHHHHHHHHhhhccccccccccc
Confidence            9875432211   11111111100000         0000000          00000000                   


Q ss_pred             --------------------------------------------------------------------------------
Q 019285          241 --------------------------------------------------------------------------------  240 (343)
Q Consensus       241 --------------------------------------------------------------------------------  240 (343)
                                                                                                      
T Consensus       243 ~~~~~~~~~~~~~~~~~~~~ls~~ei~~~~l~l~~Ag~~tta~~l~~~l~~L~~~Pe~~~klr~Ei~~~~~~~~~~~~~~  322 (472)
T d1tqna_         243 DFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDT  322 (472)
T ss_dssp             CHHHHHHHHHCC----CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHSTTTCCCCHHH
T ss_pred             chhhhhhhcccccccccccchhhhHHHhhhhhhhhcccccccccceeeccccccCccccccccceeheeccccccchHHH
Confidence                                                                                            


Q ss_pred             ---------HHHhhhccccCCccccccccCCceecCEEeCCCCEEEeechhhhcCCCCCCCCCCCCCCCCCCCC---CCC
Q 019285          241 ---------VIDETLRLMNLPFLDFREAKTDANIKGYTIPKGWKVLIWNRAVHMDPENFSAPKEFDPSRWDNNA---AEP  308 (343)
Q Consensus       241 ---------~i~E~lRl~p~~~~~~R~~~~d~~l~g~~ip~g~~v~~~~~~~~~d~~~~~~p~~F~peRfl~~~---~~~  308 (343)
                               |++|++|++|+++.++|.+.+|+.++||.||||+.|+++.+.+|+||++|+||++|+||||++.+   ..+
T Consensus       323 l~~~~~l~a~i~E~lRl~p~~~~~~r~~~~d~~~~g~~ipkGt~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~~~~~  402 (472)
T d1tqna_         323 VLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDP  402 (472)
T ss_dssp             HHHCHHHHHHHHHHHHHCCTTCCEEEECCSCEEETTEEECTTCEEEECHHHHHTCTTTSSSTTSCCGGGGSTTTGGGCCT
T ss_pred             hhccccccceeeeccccCCcccccccccccCccccCceeCCCCEEEEechhhhcCchhCCCccccCccccCCCCcccCCC
Confidence                     99999999999999999999999999999999999999999999999999999999999999866   567


Q ss_pred             CCcccCCCCCCCCccHHHHHHHHHHHHHHHHhhCC
Q 019285          309 GSFIPFGGGSRRCLGIDVAKIEVSIFLHYFLLNYK  343 (343)
Q Consensus       309 ~~~~~Fg~G~r~C~G~~~a~~~~~~~l~~ll~~f~  343 (343)
                      ..++|||+|+|.|||+++|..|++++++.||++||
T Consensus       403 ~~~~~FG~G~r~C~G~~~A~~~~~~~la~ll~~f~  437 (472)
T d1tqna_         403 YIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFS  437 (472)
T ss_dssp             TTSCTTCCSTTSCTTHHHHHHHHHHHHHHHHTTEE
T ss_pred             ceecCCCCCCccChhHHHHHHHHHHHHHHHHHhCE
Confidence            78999999999999999999999999999999996



>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure