BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 019299
         (343 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1S20|A Chain A, A Novel Nad Binding Protein Revealed By The Crystal
           Structure Of E. Coli 2,3-Diketogulonate Reductase (Yiak)
           Northeast Structural Genomics Consortium Target Er82
 pdb|1S20|B Chain B, A Novel Nad Binding Protein Revealed By The Crystal
           Structure Of E. Coli 2,3-Diketogulonate Reductase (Yiak)
           Northeast Structural Genomics Consortium Target Er82
 pdb|1S20|C Chain C, A Novel Nad Binding Protein Revealed By The Crystal
           Structure Of E. Coli 2,3-Diketogulonate Reductase (Yiak)
           Northeast Structural Genomics Consortium Target Er82
 pdb|1S20|D Chain D, A Novel Nad Binding Protein Revealed By The Crystal
           Structure Of E. Coli 2,3-Diketogulonate Reductase (Yiak)
           Northeast Structural Genomics Consortium Target Er82
 pdb|1S20|E Chain E, A Novel Nad Binding Protein Revealed By The Crystal
           Structure Of E. Coli 2,3-Diketogulonate Reductase (Yiak)
           Northeast Structural Genomics Consortium Target Er82
 pdb|1S20|F Chain F, A Novel Nad Binding Protein Revealed By The Crystal
           Structure Of E. Coli 2,3-Diketogulonate Reductase (Yiak)
           Northeast Structural Genomics Consortium Target Er82
 pdb|1S20|G Chain G, A Novel Nad Binding Protein Revealed By The Crystal
           Structure Of E. Coli 2,3-Diketogulonate Reductase (Yiak)
           Northeast Structural Genomics Consortium Target Er82
 pdb|1S20|H Chain H, A Novel Nad Binding Protein Revealed By The Crystal
           Structure Of E. Coli 2,3-Diketogulonate Reductase (Yiak)
           Northeast Structural Genomics Consortium Target Er82
          Length = 340

 Score = 28.1 bits (61), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 273 GFWSGFAWLVGMTAIIALLSE--FVVGTIEDASNSWGISVSFISIILLPIVGNAAEHA 328
           G+W G    + +  I  LLS+   V    +D S+ +GIS  FI+I +  ++      A
Sbjct: 222 GYWKGSGXSIVLDXIATLLSDGASVAEVTQDNSDEYGISQIFIAIEVDKLIDGPTRDA 279


>pdb|1NXU|A Chain A, Crystal Structure Of E. Coli Hypothetical Oxidoreductase
           Yiak Northeast Structural Genomics Consortium Target
           Er82.
 pdb|1NXU|B Chain B, Crystal Structure Of E. Coli Hypothetical Oxidoreductase
           Yiak Northeast Structural Genomics Consortium Target
           Er82
          Length = 333

 Score = 28.1 bits (61), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 273 GFWSGFAWLVGMTAIIALLSE--FVVGTIEDASNSWGISVSFISIILLPIVGNAAEHA 328
           G+W G    + +  I  LLS+   V    +D S+ +GIS  FI+I +  ++      A
Sbjct: 222 GYWKGSGXSIVLDXIATLLSDGASVAEVTQDNSDEYGISQIFIAIEVDKLIDGPTRDA 279


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.137    0.411 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,374,710
Number of Sequences: 62578
Number of extensions: 221149
Number of successful extensions: 532
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 532
Number of HSP's gapped (non-prelim): 2
length of query: 343
length of database: 14,973,337
effective HSP length: 100
effective length of query: 243
effective length of database: 8,715,537
effective search space: 2117875491
effective search space used: 2117875491
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)