Citrus Sinensis ID: 019299

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340---

MASTEPWLMENGSVKVLSKEIRHGRTAHNMSSSSLRKKSDLTLVSKIRFPCLRRCLANIQEVILGTKLSVLFPAIPLAIIGQCFGFAEPWVFALSLLGLTPLAERVSFLTEQIAFYTGPTVGGLLNATCGNATELIIAIFALYGRKIDVVKYSLLGSILSNLLLVLGTSLFCGGIANLRKEQKYDRKQADVNSLLLLLALLCHMLPLLFKYAAASSDITAKATLQLSRASSIVMLIGYFAYLVFQLWTHREFFEAQEDSEDDDDVTEETPVIGFWSGFAWLVGMTAIIALLSEFVVGTIEDASNSWGISVSFISIILLPIVGNAAEHAGAIIFAFKNKLVSNK

cccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccc

****EPW*********************************LTLVSKIRFPCLRRCLANIQEVILGTKLSVLFPAIPLAIIGQCFGFAEPWVFALSLLGLTPLAERVSFLTEQIAFYTGPTVGGLLNATCGNATELIIAIFALYGRKIDVVKYSLLGSILSNLLLVLGTSLFCGGIANLRKEQKYDRKQADVNSLLLLLALLCHMLPLLFKYAAASSDITAKATLQLSRASSIVMLIGYFAYLVFQLWTHREFFEA************ETPVIGFWSGFAWLVGMTAIIALLSEFVVGTIEDASNSWGISVSFISIILLPIVGNAAEHAGAIIFAFKNKLV***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Vacuolar cation/proton exchanger 1a	Vacuolar cation/proton exchanger (CAX). Translocates Ca(2+) and other metal ions into vacuoles using the proton gradient formed by H(+)-ATPase and H(+)-pyrophosphatase.	probable	Q769E5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3V5U, chain A
Confidence level:very confident
Coverage over the Query: 103-210,222-251,269-342
View the alignment between query and template
View the model in PyMOL