Citrus Sinensis ID: 019337


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340--
MTETEVKMYRARREITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLELKANQSINQVVEVVTEAEKYNRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFRSGRSPIMTATDVAARGLGRITVC
ccHHHHHHHHHHcccEEEcccccccccccccccccHHHHHHHHHccccccccHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHcccccccccccEEEEEcccHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHccccEEEEcccHHHHHHHHcccccccccEEEEcccccccccccHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHcccEEEEEccccccccccEEEEEEEccccHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHccccEEEccccccccHHHHHHHHHHcccccEEEEEccccccccccccc
ccHHHHHHHHHHccEEEEccccccccccHHHccccHHHHHHHHHcccccccHHHcccccHEcccccEEEEEEccccHHHHHHHHHHHHHHcccccccccccEEEEEccHHHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHccEEEEcHHHHHHHHcccccccccccEEEEccHHHHHccccHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHccccEEEEcccccccHcccEEEEEEEccHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHcccccEEEEEcHHHccccccccc
MTETEVKMYRARREItveghdvprpirifqeanfpdYCLEVIAKlgfveptpiqaqgwpmalkgrdligiaetgsgktlsyllpafvhvsaqprlvqgegpivlvlaPTRELAVQIQEEALKFgsragirstciyggapkgpqirdlrRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVTqirpdrqtlywsatwpREVETLARQFLRNPYKVIIGSLELKANQSINQVVEVVTEAEKYNRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLrmdgwpalsihgdknqseRDWVLAEfrsgrspimtaTDVAARglgritvc
mtetevkmyrarreitveghdvprpiRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEAlkfgsragirSTCIyggapkgpqirdlrrGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFepqirkivtqirpdrqtlywsatwpREVETLARQFLRNPYKVIIGSlelkanqsINQVVEVVTEAEKYNRLIKLLKEVMDGSRILIFtetkkgcdqVTRQLRMDGWPAlsihgdknqserDWVLAEfrsgrspimtatdvaarglgritvc
MTETEVKMYRARREITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLELKANQSINQVVEVVTEAEKYNRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFRSGRSPIMTATDVAARGLGRITVC
*************EITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLELKANQSINQVVEVVTEAEKYNRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGD*****RDWVLAEFRS****IMTATDVAA*********
*TETEVKMYRARREITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLELKANQSINQVVEVVTEAEKYNRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFRSGRSPIMTATDVAARGLGRITVC
MTETEVKMYRARREITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLELKANQSINQVVEVVTEAEKYNRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFRSGRSPIMTATDVAARGLGRITVC
*T*TEVKMYRARREITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLELKANQSINQVVEVVTEAEKYNRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFRSGRSPIMTATDVAARGLGR****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTETEVKMYRARREITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLELKANQSINQVVEVVTEAEKYNRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFRSGRSPIMTATDVAARGLGRITVC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query342 2.2.26 [Sep-21-2011]
Q8W4R3 591 DEAD-box ATP-dependent RN no no 0.982 0.568 0.845 1e-170
Q5N7W4666 DEAD-box ATP-dependent RN no no 0.982 0.504 0.818 1e-166
Q9C718501 DEAD-box ATP-dependent RN no no 0.982 0.670 0.770 1e-162
Q5QMN3494 DEAD-box ATP-dependent RN no no 0.982 0.680 0.785 1e-161
Q59LU0 562 ATP-dependent RNA helicas N/A no 0.979 0.596 0.667 1e-134
Q6CIV2 554 ATP-dependent RNA helicas yes no 0.982 0.606 0.677 1e-133
Q5B0J9 563 ATP-dependent RNA helicas yes no 0.979 0.595 0.670 1e-133
A5DL80 554 ATP-dependent RNA helicas N/A no 0.979 0.604 0.670 1e-133
A7TTT5441 ATP-dependent RNA helicas N/A no 0.991 0.768 0.665 1e-133
A3LQW7 530 ATP-dependent RNA helicas yes no 0.979 0.632 0.670 1e-133
>sp|Q8W4R3|RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana GN=RH30 PE=2 SV=2 Back     alignment and function desciption
 Score =  597 bits (1538), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 284/336 (84%), Positives = 311/336 (92%)

Query: 1   MTETEVKMYRARREITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPM 60
           MTE +V MYR  R+I+VEG DVP+P+++FQ+ANFPD  LE IAKLGF EPTPIQAQGWPM
Sbjct: 139 MTEQDVAMYRTERDISVEGRDVPKPMKMFQDANFPDNILEAIAKLGFTEPTPIQAQGWPM 198

Query: 61  ALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEA 120
           ALKGRDLIGIAETGSGKTL+YLLPA VHVSAQPRL Q +GPIVL+LAPTRELAVQIQEE+
Sbjct: 199 ALKGRDLIGIAETGSGKTLAYLLPALVHVSAQPRLGQDDGPIVLILAPTRELAVQIQEES 258

Query: 121 LKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVL 180
            KFG R+G+RSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLE QHTNL+RVTYLVL
Sbjct: 259 RKFGLRSGVRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLECQHTNLKRVTYLVL 318

Query: 181 DEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLEL 240
           DEADRMLDMGFEPQIRKIV+QIRPDRQTL WSATWPREVETLARQFLR+PYK IIGS +L
Sbjct: 319 DEADRMLDMGFEPQIRKIVSQIRPDRQTLLWSATWPREVETLARQFLRDPYKAIIGSTDL 378

Query: 241 KANQSINQVVEVVTEAEKYNRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPAL 300
           KANQSINQV+E+V   EKYNRL+ LLK++MDGS+ILIF ETK+GCDQVTRQLRMDGWPAL
Sbjct: 379 KANQSINQVIEIVPTPEKYNRLLTLLKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPAL 438

Query: 301 SIHGDKNQSERDWVLAEFRSGRSPIMTATDVAARGL 336
           +IHGDK QSERD VLAEF+SGRSPIMTATDVAARGL
Sbjct: 439 AIHGDKTQSERDRVLAEFKSGRSPIMTATDVAARGL 474




ATP-dependent RNA helicase involved nonsense-mediated mRNA decay and ribosome biogenesis through rRNA processing.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q5N7W4|RH30_ORYSJ DEAD-box ATP-dependent RNA helicase 30 OS=Oryza sativa subsp. japonica GN=Os01g0911100 PE=2 SV=2 Back     alignment and function description
>sp|Q9C718|RH20_ARATH DEAD-box ATP-dependent RNA helicase 20 OS=Arabidopsis thaliana GN=RH20 PE=1 SV=1 Back     alignment and function description
>sp|Q5QMN3|RH20_ORYSJ DEAD-box ATP-dependent RNA helicase 20 OS=Oryza sativa subsp. japonica GN=Os01g0197200 PE=3 SV=2 Back     alignment and function description
>sp|Q59LU0|DBP2_CANAL ATP-dependent RNA helicase DBP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP2 PE=3 SV=2 Back     alignment and function description
>sp|Q6CIV2|DBP2_KLULA ATP-dependent RNA helicase DBP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP2 PE=3 SV=1 Back     alignment and function description
>sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 Back     alignment and function description
>sp|A5DL80|DBP2_PICGU ATP-dependent RNA helicase DBP2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP2 PE=3 SV=3 Back     alignment and function description
>sp|A7TTT5|DBP2_VANPO ATP-dependent RNA helicase DBP2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP2 PE=3 SV=1 Back     alignment and function description
>sp|A3LQW7|DBP2_PICST ATP-dependent RNA helicase DBP2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query342
255543421 540 dead box ATP-dependent RNA helicase, put 1.0 0.633 0.912 0.0
297733718 611 unnamed protein product [Vitis vinifera] 1.0 0.559 0.915 0.0
225456912 611 PREDICTED: DEAD-box ATP-dependent RNA he 0.982 0.549 0.913 1e-179
224121758 541 predicted protein [Populus trichocarpa] 0.982 0.621 0.904 1e-179
224135925 450 predicted protein [Populus trichocarpa] 0.982 0.746 0.904 1e-178
356513635 599 PREDICTED: DEAD-box ATP-dependent RNA he 0.982 0.560 0.892 1e-177
356562686 602 PREDICTED: DEAD-box ATP-dependent RNA he 0.982 0.558 0.880 1e-173
449440640 622 PREDICTED: DEAD-box ATP-dependent RNA he 0.982 0.540 0.872 1e-171
18424667 484 DEAD-box ATP-dependent RNA helicase 30 [ 0.982 0.694 0.845 1e-168
10177293 564 ATP-dependent RNA helicase-like protein 0.982 0.595 0.845 1e-168
>gi|255543421|ref|XP_002512773.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223547784|gb|EEF49276.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/342 (91%), Positives = 331/342 (96%)

Query: 1   MTETEVKMYRARREITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPM 60
           M+E EV MYRARR+ITVEGHDVP+PIRIFQEANFP YCLEVIAKLGFVEPTPIQAQGWPM
Sbjct: 199 MSEHEVIMYRARRDITVEGHDVPKPIRIFQEANFPGYCLEVIAKLGFVEPTPIQAQGWPM 258

Query: 61  ALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEA 120
           ALKGRD+IGIAETGSGKTL+Y+LPA VHVSAQPRLVQGEGP+VL+LAPTRELAVQIQEEA
Sbjct: 259 ALKGRDVIGIAETGSGKTLAYVLPALVHVSAQPRLVQGEGPVVLILAPTRELAVQIQEEA 318

Query: 121 LKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVL 180
           LKFGSRA IR+TCIYGGAPKGPQIRDL RGVEIVIATPGRLIDMLEAQHTNLRRVTYLVL
Sbjct: 319 LKFGSRANIRTTCIYGGAPKGPQIRDLHRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVL 378

Query: 181 DEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLEL 240
           DEADRMLDMGFEPQIRK+V+QIRPDRQTLYWSATWPREVETLARQFLRNPYKV+IGS +L
Sbjct: 379 DEADRMLDMGFEPQIRKLVSQIRPDRQTLYWSATWPREVETLARQFLRNPYKVVIGSTDL 438

Query: 241 KANQSINQVVEVVTEAEKYNRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPAL 300
           KANQSINQVVE+V+E EKYNRLIKLLKEVMDGSRILIF ETKKGCDQVTRQLRMDGWP L
Sbjct: 439 KANQSINQVVEIVSEMEKYNRLIKLLKEVMDGSRILIFMETKKGCDQVTRQLRMDGWPVL 498

Query: 301 SIHGDKNQSERDWVLAEFRSGRSPIMTATDVAARGLGRITVC 342
           SIHGDKNQ+ERDWVL+EF+SGRSPIMTATDVAARGLGRI +C
Sbjct: 499 SIHGDKNQTERDWVLSEFKSGRSPIMTATDVAARGLGRIIMC 540




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297733718|emb|CBI14965.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225456912|ref|XP_002277894.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224121758|ref|XP_002318665.1| predicted protein [Populus trichocarpa] gi|222859338|gb|EEE96885.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224135925|ref|XP_002322195.1| predicted protein [Populus trichocarpa] gi|222869191|gb|EEF06322.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356513635|ref|XP_003525517.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Glycine max] Back     alignment and taxonomy information
>gi|356562686|ref|XP_003549600.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Glycine max] Back     alignment and taxonomy information
>gi|449440640|ref|XP_004138092.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Cucumis sativus] gi|449522189|ref|XP_004168110.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18424667|ref|NP_568964.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana] gi|16974623|gb|AAL31214.1| AT5g63120/MDC12_8 [Arabidopsis thaliana] gi|23308415|gb|AAN18177.1| At5g63120/MDC12_8 [Arabidopsis thaliana] gi|332010324|gb|AED97707.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|10177293|dbj|BAB10554.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query342
TAIR|locus:2162022 591 AT5G63120 [Arabidopsis thalian 0.982 0.568 0.845 1.5e-152
TAIR|locus:2035741501 RH20 "RNA helicase 20" [Arabid 0.982 0.670 0.770 3.2e-145
CGD|CAL0003204 562 DBP2 [Candida albicans (taxid: 0.979 0.596 0.667 6.5e-122
ASPGD|ASPL0000006660 563 AN5931 [Emericella nidulans (t 0.979 0.595 0.670 1.7e-121
UNIPROTKB|A4QSS5 548 DBP2 "ATP-dependent RNA helica 0.979 0.611 0.651 6e-119
ZFIN|ZDB-GENE-030131-925 617 ddx5 "DEAD (Asp-Glu-Ala-Asp) b 0.970 0.538 0.655 2.6e-118
SGD|S000005056 546 DBP2 "ATP-dependent RNA helica 0.979 0.613 0.658 3.3e-118
ZFIN|ZDB-GENE-030131-18 671 si:dkey-156n14.5 "si:dkey-156n 0.982 0.500 0.642 7.9e-117
POMBASE|SPBP8B7.16c 550 dbp2 "ATP-dependent RNA helica 0.979 0.609 0.649 1.3e-116
UNIPROTKB|F1NM08 595 DDX5 "Uncharacterized protein" 0.979 0.563 0.637 9.1e-116
TAIR|locus:2162022 AT5G63120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1488 (528.9 bits), Expect = 1.5e-152, P = 1.5e-152
 Identities = 284/336 (84%), Positives = 311/336 (92%)

Query:     1 MTETEVKMYRARREITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPM 60
             MTE +V MYR  R+I+VEG DVP+P+++FQ+ANFPD  LE IAKLGF EPTPIQAQGWPM
Sbjct:   139 MTEQDVAMYRTERDISVEGRDVPKPMKMFQDANFPDNILEAIAKLGFTEPTPIQAQGWPM 198

Query:    61 ALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEA 120
             ALKGRDLIGIAETGSGKTL+YLLPA VHVSAQPRL Q +GPIVL+LAPTRELAVQIQEE+
Sbjct:   199 ALKGRDLIGIAETGSGKTLAYLLPALVHVSAQPRLGQDDGPIVLILAPTRELAVQIQEES 258

Query:   121 LKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVL 180
              KFG R+G+RSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLE QHTNL+RVTYLVL
Sbjct:   259 RKFGLRSGVRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLECQHTNLKRVTYLVL 318

Query:   181 DEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLEL 240
             DEADRMLDMGFEPQIRKIV+QIRPDRQTL WSATWPREVETLARQFLR+PYK IIGS +L
Sbjct:   319 DEADRMLDMGFEPQIRKIVSQIRPDRQTLLWSATWPREVETLARQFLRDPYKAIIGSTDL 378

Query:   241 KANQSINQVVEVVTEAEKYNRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPAL 300
             KANQSINQV+E+V   EKYNRL+ LLK++MDGS+ILIF ETK+GCDQVTRQLRMDGWPAL
Sbjct:   379 KANQSINQVIEIVPTPEKYNRLLTLLKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPAL 438

Query:   301 SIHGDKNQSERDWVLAEFRSGRSPIMTATDVAARGL 336
             +IHGDK QSERD VLAEF+SGRSPIMTATDVAARGL
Sbjct:   439 AIHGDKTQSERDRVLAEFKSGRSPIMTATDVAARGL 474




GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS
TAIR|locus:2035741 RH20 "RNA helicase 20" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0003204 DBP2 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
ASPGD|ASPL0000006660 AN5931 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|A4QSS5 DBP2 "ATP-dependent RNA helicase DBP2" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-925 ddx5 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
SGD|S000005056 DBP2 "ATP-dependent RNA helicase of the DEAD-box protein family" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-18 si:dkey-156n14.5 "si:dkey-156n14.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
POMBASE|SPBP8B7.16c dbp2 "ATP-dependent RNA helicase Dbp2" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|F1NM08 DDX5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6CIV2DBP2_KLULA3, ., 6, ., 4, ., 1, 30.67750.98240.6064yesno
P0CQ76DBP2_CRYNJ3, ., 6, ., 4, ., 1, 30.65170.97950.6203yesno
Q8SRB2DBP2_ENCCU3, ., 6, ., 4, ., 1, 30.53270.97950.6767yesno
Q6BY27DBP2_DEBHA3, ., 6, ., 4, ., 1, 30.67060.97070.6194yesno
A3LQW7DBP2_PICST3, ., 6, ., 4, ., 1, 30.67060.97950.6320yesno
Q6FLF3DBP2_CANGA3, ., 6, ., 4, ., 1, 30.67350.97950.6158yesno
Q4X195DBP2_ASPFU3, ., 6, ., 4, ., 1, 30.66460.97950.6124yesno
Q755N4DBP2_ASHGO3, ., 6, ., 4, ., 1, 30.66560.98240.6032yesno
Q2U070DBP2_ASPOR3, ., 6, ., 4, ., 1, 30.65870.97950.6046yesno
P24783DBP2_YEAST3, ., 6, ., 4, ., 1, 30.65870.97950.6135yesno
P24782DBP2_SCHPO3, ., 6, ., 4, ., 1, 30.64980.97950.6090yesno
Q6C4D4DBP2_YARLI3, ., 6, ., 4, ., 1, 30.66760.97950.6068yesno
Q4IF76DBP2_GIBZE3, ., 6, ., 4, ., 1, 30.65870.97950.6036yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.946
3rd Layer3.6.40.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00015999001
SubName- Full=Chromosome chr17 scaffold_12, whole genome shotgun sequence; (423 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query342
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 0.0
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 1e-119
cd00268203 cd00268, DEADc, DEAD-box helicases 1e-103
PRK11776 460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 1e-85
PRK10590 456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 3e-76
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 2e-67
PRK11192 434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 4e-65
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 9e-61
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 2e-60
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 1e-59
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 2e-59
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 1e-58
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 2e-56
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 6e-56
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 1e-43
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 3e-18
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 1e-16
COG1205 851 COG1205, COG1205, Distinct helicase family with a 8e-15
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 1e-13
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 2e-11
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-10
smart0049082 smart00490, HELICc, helicase superfamily c-termina 1e-10
TIGR03817 742 TIGR03817, DECH_helic, helicase/secretion neighbor 2e-09
COG1202 830 COG1202, COG1202, Superfamily II helicase, archaea 2e-08
TIGR04121 803 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA 6e-08
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 1e-07
TIGR00614 470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 1e-05
TIGR01389 591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 3e-05
PRK13766 773 PRK13766, PRK13766, Hef nuclease; Provisional 5e-04
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
 Score =  537 bits (1386), Expect = 0.0
 Identities = 219/339 (64%), Positives = 264/339 (77%), Gaps = 3/339 (0%)

Query: 1   MTETEVKMYRARREIT-VEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWP 59
           ++  EV   R  +EIT + G +VP+P+  F+  +FPDY L+ +   GF EPTPIQ QGWP
Sbjct: 103 LSSKEVDEIRKEKEITIIAGENVPKPVVSFEYTSFPDYILKSLKNAGFTEPTPIQVQGWP 162

Query: 60  MALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEE 119
           +AL GRD+IGIAETGSGKTL++LLPA VH++AQP L  G+GPIVLVLAPTRELA QI+E+
Sbjct: 163 IALSGRDMIGIAETGSGKTLAFLLPAIVHINAQPLLRYGDGPIVLVLAPTRELAEQIREQ 222

Query: 120 ALKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLV 179
             KFG+ + IR+T  YGG PK  QI  LRRGVEI+IA PGRLID LE+  TNLRRVTYLV
Sbjct: 223 CNKFGASSKIRNTVAYGGVPKRGQIYALRRGVEILIACPGRLIDFLESNVTNLRRVTYLV 282

Query: 180 LDEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRN-PYKVIIGSL 238
           LDEADRMLDMGFEPQIRKIV+QIRPDRQTL WSATWP+EV++LAR   +  P  V +GSL
Sbjct: 283 LDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVQSLARDLCKEEPVHVNVGSL 342

Query: 239 ELKANQSINQVVEVVTEAEKYNRLIKLLKEVM-DGSRILIFTETKKGCDQVTRQLRMDGW 297
           +L A  +I Q V VV E EK  +L  LL+ +M DG +ILIF ETKKG D +T++LR+DGW
Sbjct: 343 DLTACHNIKQEVFVVEEHEKRGKLKMLLQRIMRDGDKILIFVETKKGADFLTKELRLDGW 402

Query: 298 PALSIHGDKNQSERDWVLAEFRSGRSPIMTATDVAARGL 336
           PAL IHGDK Q ER WVL EF++G+SPIM ATDVA+RGL
Sbjct: 403 PALCIHGDKKQEERTWVLNEFKTGKSPIMIATDVASRGL 441


Length = 545

>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 342
PTZ00110545 helicase; Provisional 100.0
KOG0331 519 consensus ATP-dependent RNA helicase [RNA processi 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
KOG0330 476 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0339 731 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
PTZ00424401 helicase 45; Provisional 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0340 442 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0342 543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0338 691 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0341 610 consensus DEAD-box protein abstrakt [RNA processin 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0345 567 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0343 758 consensus RNA Helicase [RNA processing and modific 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0334 997 consensus RNA helicase [RNA processing and modific 100.0
KOG0346 569 consensus RNA helicase [RNA processing and modific 100.0
KOG0348 708 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG0347 731 consensus RNA helicase [RNA processing and modific 100.0
KOG0337 529 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
KOG0327397 consensus Translation initiation factor 4F, helica 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
KOG4284 980 consensus DEAD box protein [Transcription] 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 100.0
PRK01172 674 ski2-like helicase; Provisional 100.0
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
KOG0344 593 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 100.0
KOG0350 620 consensus DEAD-box ATP-dependent RNA helicase [RNA 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
PRK10689 1147 transcription-repair coupling factor; Provisional 100.0
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 100.0
COG1204 766 Superfamily II helicase [General function predicti 100.0
PRK14701 1638 reverse gyrase; Provisional 100.0
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
COG1202 830 Superfamily II helicase, archaea-specific [General 100.0
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
KOG0354 746 consensus DEAD-box like helicase [General function 100.0
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 100.0
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 100.0
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 100.0
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 100.0
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 100.0
PHA02653 675 RNA helicase NPH-II; Provisional 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
COG1205 851 Distinct helicase family with a unique C-terminal 99.98
PRK13766 773 Hef nuclease; Provisional 99.98
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.97
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.97
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.97
KOG0353 695 consensus ATP-dependent DNA helicase [General func 99.97
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 99.96
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.96
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.96
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.96
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 99.96
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.96
PRK05580 679 primosome assembly protein PriA; Validated 99.96
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.95
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.95
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.95
PRK09694 878 helicase Cas3; Provisional 99.95
TIGR00595 505 priA primosomal protein N'. All proteins in this f 99.95
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.95
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 99.95
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.94
KOG0349 725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.94
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.94
PRK04914 956 ATP-dependent helicase HepA; Validated 99.94
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.93
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.92
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.92
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.91
COG4096 875 HsdR Type I site-specific restriction-modification 99.91
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.91
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.9
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 99.89
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.89
smart00487201 DEXDc DEAD-like helicases superfamily. 99.89
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.89
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.89
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 99.88
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.88
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.88
COG1198 730 PriA Primosomal protein N' (replication factor Y) 99.86
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 99.85
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.84
KOG1123 776 consensus RNA polymerase II transcription initiati 99.84
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.84
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.83
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.81
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.8
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.8
COG4889 1518 Predicted helicase [General function prediction on 99.79
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 99.79
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.77
KOG0387 923 consensus Transcription-coupled repair protein CSB 99.77
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.76
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 99.76
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.75
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 99.73
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.73
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.72
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 99.71
KOG1000 689 consensus Chromatin remodeling protein HARP/SMARCA 99.71
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.71
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 99.71
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 99.71
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 99.66
KOG0390 776 consensus DNA repair protein, SNF2 family [Replica 99.65
KOG0392 1549 consensus SNF2 family DNA-dependent ATPase domain- 99.64
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 99.63
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 99.61
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 99.61
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 99.61
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 99.59
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.58
PRK05298 652 excinuclease ABC subunit B; Provisional 99.57
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.55
KOG0953 700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.55
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.53
KOG1002 791 consensus Nucleotide excision repair protein RAD16 99.45
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.45
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 99.44
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 99.43
KOG4439 901 consensus RNA polymerase II transcription terminat 99.42
COG0610 962 Type I site-specific restriction-modification syst 99.42
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 99.42
smart00489289 DEXDc3 DEAD-like helicases superfamily. 99.36
smart00488289 DEXDc2 DEAD-like helicases superfamily. 99.36
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 99.35
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 99.34
PRK14873 665 primosome assembly protein PriA; Provisional 99.31
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.3
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.28
KOG0388 1185 consensus SNF2 family DNA-dependent ATPase [Replic 99.26
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 99.2
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 99.2
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 99.15
KOG1015 1567 consensus Transcription regulator XNP/ATRX, DEAD-b 99.06
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 99.02
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 98.99
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.91
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 98.9
KOG1802 935 consensus RNA helicase nonsense mRNA reducing fact 98.9
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family 98.89
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.86
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 98.85
PRK15483 986 type III restriction-modification system StyLTI en 98.84
KOG2340698 consensus Uncharacterized conserved protein [Funct 98.82
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 98.8
smart0049082 HELICc helicase superfamily c-terminal domain. 98.75
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 98.61
TIGR00376 637 DNA helicase, putative. The gene product may repre 98.53
PRK10536262 hypothetical protein; Provisional 98.53
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 98.51
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 98.49
PRK10875 615 recD exonuclease V subunit alpha; Provisional 98.48
KOG1803 649 consensus DNA helicase [Replication, recombination 98.47
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 98.45
KOG1132 945 consensus Helicase of the DEAD superfamily [Replic 98.42
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 98.25
TIGR02768 744 TraA_Ti Ti-type conjugative transfer relaxase TraA 98.24
PF1324576 AAA_19: Part of AAA domain 98.23
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 98.2
KOG1805 1100 consensus DNA replication helicase [Replication, r 98.18
PRK13889 988 conjugal transfer relaxase TraA; Provisional 98.12
PRK04296190 thymidine kinase; Provisional 98.07
PRK13826 1102 Dtr system oriT relaxase; Provisional 98.04
KOG1131 755 consensus RNA polymerase II transcription initiati 98.03
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 98.02
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 98.01
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 98.01
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.98
COG3587 985 Restriction endonuclease [Defense mechanisms] 97.98
PRK06526254 transposase; Provisional 97.94
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.89
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.88
PRK08181269 transposase; Validated 97.87
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.84
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 97.78
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.77
KOG0298 1394 consensus DEAD box-containing helicase-like transc 97.73
PRK14974336 cell division protein FtsY; Provisional 97.73
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 97.64
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.64
smart00382148 AAA ATPases associated with a variety of cellular 97.61
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.56
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 97.56
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 97.56
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.55
PRK11054 684 helD DNA helicase IV; Provisional 97.54
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 97.48
PRK07952244 DNA replication protein DnaC; Validated 97.48
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 97.44
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 97.42
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 97.42
PRK06921266 hypothetical protein; Provisional 97.4
PRK12377248 putative replication protein; Provisional 97.4
PRK08116268 hypothetical protein; Validated 97.39
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.38
PRK06835329 DNA replication protein DnaC; Validated 97.35
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 97.33
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.32
PTZ00293211 thymidine kinase; Provisional 97.31
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 97.28
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 97.28
KOG0383696 consensus Predicted helicase [General function pre 97.26
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.25
PRK08727233 hypothetical protein; Validated 97.24
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.23
PRK05642234 DNA replication initiation factor; Validated 97.22
PHA02533 534 17 large terminase protein; Provisional 97.22
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 97.21
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 97.19
PHA03333 752 putative ATPase subunit of terminase; Provisional 97.19
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 97.19
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 97.14
PRK00149450 dnaA chromosomal replication initiation protein; R 97.13
PTZ00112 1164 origin recognition complex 1 protein; Provisional 97.11
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 97.11
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.09
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 97.09
PRK14087450 dnaA chromosomal replication initiation protein; P 97.08
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 97.05
PRK06893229 DNA replication initiation factor; Validated 97.05
TIGR00362405 DnaA chromosomal replication initiator protein Dna 97.04
PF00004132 AAA: ATPase family associated with various cellula 97.04
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 97.03
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 97.02
PRK08084235 DNA replication initiation factor; Provisional 97.02
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.0
PRK00771437 signal recognition particle protein Srp54; Provisi 96.99
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 96.99
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 96.98
COG3973 747 Superfamily I DNA and RNA helicases [General funct 96.97
PRK12422445 chromosomal replication initiation protein; Provis 96.97
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 96.94
PRK05707328 DNA polymerase III subunit delta'; Validated 96.94
PRK09183259 transposase/IS protein; Provisional 96.91
PRK14086617 dnaA chromosomal replication initiation protein; P 96.87
PRK08903227 DnaA regulatory inactivator Hda; Validated 96.87
PRK12402337 replication factor C small subunit 2; Reviewed 96.86
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 96.84
PHA02544316 44 clamp loader, small subunit; Provisional 96.82
PF03354 477 Terminase_1: Phage Terminase ; InterPro: IPR005021 96.82
TIGR01547 396 phage_term_2 phage terminase, large subunit, PBSX 96.82
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 96.81
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 96.81
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 96.8
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 96.78
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.77
PRK11331459 5-methylcytosine-specific restriction enzyme subun 96.77
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 96.76
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 96.75
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 96.74
PLN03025319 replication factor C subunit; Provisional 96.74
COG2256 436 MGS1 ATPase related to the helicase subunit of the 96.74
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 96.73
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 96.73
PRK14088440 dnaA chromosomal replication initiation protein; P 96.72
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 96.7
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 96.69
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 96.68
PRK04195 482 replication factor C large subunit; Provisional 96.66
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.64
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 96.61
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 96.61
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 96.6
COG4626 546 Phage terminase-like protein, large subunit [Gener 96.6
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 96.59
PRK08769319 DNA polymerase III subunit delta'; Validated 96.57
PRK08533230 flagellar accessory protein FlaH; Reviewed 96.57
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 96.57
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 96.55
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 96.55
PHA03368 738 DNA packaging terminase subunit 1; Provisional 96.55
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 96.54
PRK05973237 replicative DNA helicase; Provisional 96.54
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 96.52
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.51
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 96.49
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 96.47
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 96.47
COG0470325 HolB ATPase involved in DNA replication [DNA repli 96.47
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.44
TIGR00064272 ftsY signal recognition particle-docking protein F 96.44
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 96.43
COG3972 660 Superfamily I DNA and RNA helicases [General funct 96.43
PRK13833323 conjugal transfer protein TrbB; Provisional 96.42
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 96.42
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 96.41
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 96.41
PRK08939306 primosomal protein DnaI; Reviewed 96.39
PRK14873 665 primosome assembly protein PriA; Provisional 96.39
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.38
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 96.37
PRK13894319 conjugal transfer ATPase TrbB; Provisional 96.35
PRK13342413 recombination factor protein RarA; Reviewed 96.35
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 96.34
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 96.33
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 96.31
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 96.29
PRK06067234 flagellar accessory protein FlaH; Validated 96.28
PRK11823 446 DNA repair protein RadA; Provisional 96.26
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 96.25
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 96.25
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 96.23
PRK13341 725 recombination factor protein RarA/unknown domain f 96.23
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 96.23
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 96.22
PHA00729226 NTP-binding motif containing protein 96.2
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 96.19
PF02572172 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase 96.17
PF13173128 AAA_14: AAA domain 96.17
COG2109198 BtuR ATP:corrinoid adenosyltransferase [Coenzyme m 96.16
CHL00181287 cbbX CbbX; Provisional 96.15
KOG1133 821 consensus Helicase of the DEAD superfamily [Replic 96.12
COG1198 730 PriA Primosomal protein N' (replication factor Y) 96.1
TIGR02688449 conserved hypothetical protein TIGR02688. Members 96.08
TIGR00959428 ffh signal recognition particle protein. This mode 96.08
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 96.07
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 96.07
PRK05580 679 primosome assembly protein PriA; Validated 96.04
TIGR00595 505 priA primosomal protein N'. All proteins in this f 96.03
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 96.02
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 96.01
PRK10867433 signal recognition particle protein; Provisional 96.01
PF00265176 TK: Thymidine kinase; InterPro: IPR001267 Thymidin 96.01
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 95.99
TIGR02928365 orc1/cdc6 family replication initiation protein. M 95.98
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 95.98
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 95.97
cd03115173 SRP The signal recognition particle (SRP) mediates 95.97
COG0593408 DnaA ATPase involved in DNA replication initiation 95.96
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 95.96
PF05876 557 Terminase_GpA: Phage terminase large subunit (GpA) 95.95
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 95.93
KOG2028 554 consensus ATPase related to the helicase subunit o 95.9
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 95.89
PRK06964342 DNA polymerase III subunit delta'; Validated 95.88
PRK09376416 rho transcription termination factor Rho; Provisio 95.87
PRK06871325 DNA polymerase III subunit delta'; Validated 95.86
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 95.85
smart00492141 HELICc3 helicase superfamily c-terminal domain. 95.81
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 95.81
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 95.8
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 95.79
COG1618179 Predicted nucleotide kinase [Nucleotide transport 95.78
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 95.76
PHA03372 668 DNA packaging terminase subunit 1; Provisional 95.75
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 95.72
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 95.71
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 95.7
PRK06620214 hypothetical protein; Validated 95.68
PRK07993334 DNA polymerase III subunit delta'; Validated 95.67
PRK00440319 rfc replication factor C small subunit; Reviewed 95.65
PRK06090319 DNA polymerase III subunit delta'; Validated 95.64
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 95.62
PRK07471365 DNA polymerase III subunit delta'; Validated 95.61
PRK13851344 type IV secretion system protein VirB11; Provision 95.61
KOG2228408 consensus Origin recognition complex, subunit 4 [R 95.6
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 95.59
PF03237 384 Terminase_6: Terminase-like family; InterPro: IPR0 95.58
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 95.55
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 95.54
PF02456369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 95.54
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 95.52
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 95.52
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 95.48
PRK10416318 signal recognition particle-docking protein FtsY; 95.47
COG0552340 FtsY Signal recognition particle GTPase [Intracell 95.45
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 95.43
cd01128249 rho_factor Transcription termination factor rho is 95.41
PHA00012361 I assembly protein 95.41
PRK08699325 DNA polymerase III subunit delta'; Validated 95.4
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 95.39
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 95.35
PRK04841 903 transcriptional regulator MalT; Provisional 95.33
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 95.32
PRK07940 394 DNA polymerase III subunit delta'; Validated 95.32
TIGR00767415 rho transcription termination factor Rho. Members 95.31
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 95.3
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; 95.3
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 95.27
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 95.26
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 95.25
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 95.23
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 95.23
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 95.2
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 95.18
TIGR02012321 tigrfam_recA protein RecA. This model describes or 95.18
PRK09112351 DNA polymerase III subunit delta'; Validated 95.18
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 95.18
smart00491142 HELICc2 helicase superfamily c-terminal domain. 95.16
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 95.16
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 95.15
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 95.13
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 95.09
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 95.08
PRK08506472 replicative DNA helicase; Provisional 95.05
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 95.03
PRK09354349 recA recombinase A; Provisional 94.98
PRK06904472 replicative DNA helicase; Validated 94.97
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 94.92
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 94.86
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 94.85
PRK10436462 hypothetical protein; Provisional 94.83
COG2255332 RuvB Holliday junction resolvasome, helicase subun 94.82
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 94.79
CHL00095 821 clpC Clp protease ATP binding subunit 94.75
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 94.75
PRK13764602 ATPase; Provisional 94.68
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 94.67
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 94.66
TIGR02533486 type_II_gspE general secretory pathway protein E. 94.63
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 94.57
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 94.46
TIGR00665434 DnaB replicative DNA helicase. This model describe 94.4
PRK10865 857 protein disaggregation chaperone; Provisional 94.4
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 94.36
PRK08840464 replicative DNA helicase; Provisional 94.36
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA repl 94.36
KOG1807 1025 consensus Helicases [Replication, recombination an 94.34
PRK04328249 hypothetical protein; Provisional 94.34
cd01126 384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 94.29
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 94.27
PRK07004460 replicative DNA helicase; Provisional 94.25
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 94.23
PHA00350 399 putative assembly protein 94.21
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 94.2
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 94.2
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 94.15
PF12846304 AAA_10: AAA-like domain 94.13
PRK13897 606 type IV secretion system component VirD4; Provisio 94.12
PF02534 469 T4SS-DNA_transf: Type IV secretory system Conjugat 94.06
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 94.01
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 94.01
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 93.98
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 93.97
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 93.96
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 93.95
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 93.92
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 93.88
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 93.81
PRK10689 1147 transcription-repair coupling factor; Provisional 93.8
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 93.8
PRK08058329 DNA polymerase III subunit delta'; Validated 93.79
PRK08006471 replicative DNA helicase; Provisional 93.77
PRK07399314 DNA polymerase III subunit delta'; Validated 93.73
cd03239178 ABC_SMC_head The structural maintenance of chromos 93.67
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 93.65
PRK08760476 replicative DNA helicase; Provisional 93.58
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 93.57
PHA02535 581 P terminase ATPase subunit; Provisional 93.51
PF05729166 NACHT: NACHT domain 93.51
PRK13695174 putative NTPase; Provisional 93.47
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 93.44
PRK12608380 transcription termination factor Rho; Provisional 93.38
PRK05595444 replicative DNA helicase; Provisional 93.37
PRK14701 1638 reverse gyrase; Provisional 93.31
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 93.28
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 93.27
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 93.26
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 93.22
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 93.19
CHL00176 638 ftsH cell division protein; Validated 93.17
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 93.16
KOG1806 1320 consensus DEAD box containing helicases [Replicati 93.09
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 93.03
PRK05636505 replicative DNA helicase; Provisional 93.0
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 92.98
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 92.98
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 92.97
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 92.94
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 92.93
>PTZ00110 helicase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2e-55  Score=400.30  Aligned_cols=342  Identities=64%  Similarity=1.047  Sum_probs=305.2

Q ss_pred             CChHHHHHhhhhcceee-eccCCCccccccccCCCCHHHHHHHHHcCCCCCcHHHHhhHHHHhcCCCEEEEcCCCCchhh
Q 019337            1 MTETEVKMYRARREITV-EGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTL   79 (342)
Q Consensus         1 ~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~Q~~~~~~~~~~~~~l~~~~tG~GKT~   79 (342)
                      |+++++..++.+..+.+ .|...|.|...|+++++++++.+.+...||..|+++|.++|+.+++|+++++++|||+|||+
T Consensus       103 ~~~~~~~~~~~~~~i~~~~g~~~p~p~~~f~~~~l~~~l~~~l~~~g~~~pt~iQ~~aip~~l~G~dvI~~ApTGSGKTl  182 (545)
T PTZ00110        103 LSSKEVDEIRKEKEITIIAGENVPKPVVSFEYTSFPDYILKSLKNAGFTEPTPIQVQGWPIALSGRDMIGIAETGSGKTL  182 (545)
T ss_pred             CCHHHHHHHHHhcCcEEecCCCCCcccCCHhhcCCCHHHHHHHHHCCCCCCCHHHHHHHHHHhcCCCEEEEeCCCChHHH
Confidence            57788999999998886 78899999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhHHHHHHhhhcCCCccCCCCceEEEEcCcHHHHHHHHHHHHHhcCCCCeEEEEEecCCcchhhHHhhcCCCcEEEeChH
Q 019337           80 SYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPG  159 (342)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~vlil~p~~~l~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iiv~T~~  159 (342)
                      +|+++++.++...+....+.++.+|||+|+++|+.|+.+.+++|+...++.+..++|+.+...+...+..+++|+|+||+
T Consensus       183 aylLP~l~~i~~~~~~~~~~gp~~LIL~PTreLa~Qi~~~~~~~~~~~~i~~~~~~gg~~~~~q~~~l~~~~~IlVaTPg  262 (545)
T PTZ00110        183 AFLLPAIVHINAQPLLRYGDGPIVLVLAPTRELAEQIREQCNKFGASSKIRNTVAYGGVPKRGQIYALRRGVEILIACPG  262 (545)
T ss_pred             HHHHHHHHHHHhcccccCCCCcEEEEECChHHHHHHHHHHHHHHhcccCccEEEEeCCCCHHHHHHHHHcCCCEEEECHH
Confidence            99999988876544333345789999999999999999999999988899999999998888888888888999999999


Q ss_pred             HHHHHHhccccCCCCccEEEEeccchhhcCCChHHHHHHHhhcCCCccEEEEEeecCchHHHHHHHhcC-CCeEEEeccc
Q 019337          160 RLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLR-NPYKVIIGSL  238 (342)
Q Consensus       160 ~l~~~~~~~~~~~~~~~~iIvDE~h~~~~~~~~~~~~~~~~~~~~~~~~i~~SaT~~~~~~~~~~~~~~-~~~~~~~~~~  238 (342)
                      +|.+++......+..++++|+||||++++.+|...+..++..+++..|++++|||++..+..+...++. .+..+.+...
T Consensus       263 rL~d~l~~~~~~l~~v~~lViDEAd~mld~gf~~~i~~il~~~~~~~q~l~~SAT~p~~v~~l~~~l~~~~~v~i~vg~~  342 (545)
T PTZ00110        263 RLIDFLESNVTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVQSLARDLCKEEPVHVNVGSL  342 (545)
T ss_pred             HHHHHHHcCCCChhhCcEEEeehHHhhhhcchHHHHHHHHHhCCCCCeEEEEEeCCCHHHHHHHHHHhccCCEEEEECCC
Confidence            999999888888899999999999999999999999999999989999999999999998888888775 4665555443


Q ss_pred             ccccccccceEEEEechhhHHHHHHHHHHhhc-CCCcEEEEeCCchhHHHHHHHHHhCCCCcEeecCCCCHHHHHHHHHH
Q 019337          239 ELKANQSINQVVEVVTEAEKYNRLIKLLKEVM-DGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAE  317 (342)
Q Consensus       239 ~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~-~~~~~lvf~~~~~~~~~l~~~L~~~~~~~~~~~~~~~~~~r~~~~~~  317 (342)
                      .......+...+.......+...+..++.... .++++||||++++.++.+++.|...++++..+||++++.+|..+++.
T Consensus       343 ~l~~~~~i~q~~~~~~~~~k~~~L~~ll~~~~~~~~k~LIF~~t~~~a~~l~~~L~~~g~~~~~ihg~~~~~eR~~il~~  422 (545)
T PTZ00110        343 DLTACHNIKQEVFVVEEHEKRGKLKMLLQRIMRDGDKILIFVETKKGADFLTKELRLDGWPALCIHGDKKQEERTWVLNE  422 (545)
T ss_pred             ccccCCCeeEEEEEEechhHHHHHHHHHHHhcccCCeEEEEecChHHHHHHHHHHHHcCCcEEEEECCCcHHHHHHHHHH
Confidence            33334455566666677778888888888765 57899999999999999999999999999999999999999999999


Q ss_pred             HhcCCCCEEEEecccccCCCCCCCC
Q 019337          318 FRSGRSPIMTATDVAARGLGRITVC  342 (342)
Q Consensus       318 f~~~~~~vlv~t~~~~~Gidip~v~  342 (342)
                      |++|+.+|||||+++++|||+|+|+
T Consensus       423 F~~G~~~ILVaTdv~~rGIDi~~v~  447 (545)
T PTZ00110        423 FKTGKSPIMIATDVASRGLDVKDVK  447 (545)
T ss_pred             HhcCCCcEEEEcchhhcCCCcccCC
Confidence            9999999999999999999999985



>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PHA00012 I assembly protein Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1807 consensus Helicases [Replication, recombination and repair] Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PHA00350 putative assembly protein Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PHA02535 P terminase ATPase subunit; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair] Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query342
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 5e-93
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 2e-91
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 3e-70
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 4e-65
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 2e-60
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 3e-46
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 4e-46
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 4e-46
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 5e-46
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 5e-46
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 5e-46
2hyi_C413 Structure Of The Human Exon Junction Complex With A 6e-46
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 1e-45
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 6e-43
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 1e-42
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 2e-42
2vso_A395 Crystal Structure Of A Translation Initiation Compl 8e-42
1fuu_A394 Yeast Initiation Factor 4a Length = 394 2e-39
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 1e-37
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 3e-37
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 3e-37
3ly5_A262 Ddx18 Dead-Domain Length = 262 1e-31
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 3e-31
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 3e-31
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 9e-31
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 9e-31
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 2e-30
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 2e-30
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 2e-30
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 8e-29
3i5x_A 563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 6e-28
3sqw_A 579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 6e-28
3sqx_A 512 Structure Of Mss116p (Nte And C-Tail Double Deletio 7e-28
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 3e-27
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 3e-27
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 4e-27
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 8e-27
3dkp_A245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 2e-26
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 2e-26
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 1e-24
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 2e-21
2oxc_A230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 4e-21
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 1e-19
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 1e-19
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 1e-19
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 2e-19
2jgn_A185 Ddx3 Helicase Domain Length = 185 3e-16
2kbe_A226 Solution Structure Of Amino-Terminal Domain Of Dbp5 3e-16
3fmo_B300 Crystal Structure Of The Nucleoporin Nup214 In Comp 1e-11
3fhc_B235 Crystal Structure Of Human Dbp5 In Complex With Nup 1e-11
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 6e-10
3eaq_A 212 Novel Dimerization Motif In The Dead Box Rna Helica 7e-10
3i32_A 300 Dimeric Structure Of A Hera Helicase Fragment Inclu 9e-10
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 2e-09
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 2e-08
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 2e-08
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 3e-08
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 8e-08
2ykg_A 696 Structural Insights Into Rna Recognition By Rig-I L 4e-05
4ay2_A 687 Capturing 5' Tri-Phosphorylated Rna Duplex By Rig-I 4e-05
3tmi_A 695 Structural Basis For Rna Recognition And Activation 4e-05
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 1e-04
2v1x_A 591 Crystal Structure Of Human Recq-Like Dna Helicase L 8e-04
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure

Iteration: 1

Score = 337 bits (865), Expect = 5e-93, Method: Compositional matrix adjust. Identities = 162/239 (67%), Positives = 190/239 (79%) Query: 2 TETEVKMYRARREITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMA 61 T EV+ YR +EITV GH+ P+P+ F EANFP ++VIA+ F EPT IQAQGWP+A Sbjct: 4 TAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVA 63 Query: 62 LKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEAL 121 L G D++G+A+TGSGKTLSYLLPA VH++ QP L +G+GPI LVLAPTRELA Q+Q+ A Sbjct: 64 LSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAA 123 Query: 122 KFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLD 181 ++ ++STCIYGGAPKGPQIRDL RGVEI IATPGRLID LE TNLRR TYLVLD Sbjct: 124 EYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLD 183 Query: 182 EADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLEL 240 EADRMLDMGFEPQIRKIV QIRPDRQTL WSATWP+EV LA FL++ + IG+LEL Sbjct: 184 EADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALEL 242
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 Back     alignment and structure
>pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|2YKG|A Chain A, Structural Insights Into Rna Recognition By Rig-I Length = 696 Back     alignment and structure
>pdb|4AY2|A Chain A, Capturing 5' Tri-Phosphorylated Rna Duplex By Rig-I Length = 687 Back     alignment and structure
>pdb|3TMI|A Chain A, Structural Basis For Rna Recognition And Activation Of Rig-I Length = 695 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|2V1X|A Chain A, Crystal Structure Of Human Recq-Like Dna Helicase Length = 591 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query342
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 0.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 0.0
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 1e-169
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 1e-147
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 1e-139
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 1e-129
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 1e-107
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 1e-106
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 1e-105
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 1e-102
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 1e-102
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 1e-102
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 1e-102
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 1e-101
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 1e-100
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 6e-97
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 3e-96
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 4e-92
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 6e-92
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 8e-90
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 2e-88
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 1e-84
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 4e-81
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 1e-79
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 4e-78
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 8e-78
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 2e-74
3bor_A237 Human initiation factor 4A-II; translation initiat 7e-74
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 8e-71
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 4e-70
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-62
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 3e-52
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 3e-51
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 4e-25
3eaq_A 212 Heat resistant RNA dependent ATPase; DEAD box RNA 1e-22
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 1e-22
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 1e-21
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 2e-21
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 5e-21
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 1e-10
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 6e-20
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 2e-19
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 6e-14
1yks_A 440 Genome polyprotein [contains: flavivirin protease 4e-12
3b6e_A216 Interferon-induced helicase C domain-containing P; 1e-10
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 4e-10
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 6e-10
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 1e-09
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 1e-09
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 1e-09
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 1e-09
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 2e-09
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 6e-09
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 2e-08
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 2e-08
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 3e-08
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 2e-07
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 4e-07
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 2e-06
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 2e-06
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 4e-06
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 4e-06
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 6e-06
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
 Score =  582 bits (1502), Expect = 0.0
 Identities = 129/325 (39%), Positives = 195/325 (60%), Gaps = 5/325 (1%)

Query: 14  EITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAET 73
            + V G DVP+PI+ F  A+  D  ++ + K G+  PTPIQ    P+   GRDL+  A+T
Sbjct: 43  PVKVTGSDVPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQT 102

Query: 74  GSGKTLSYLLPAFVHVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTC 133
           GSGKT ++LLP    +   P  ++   P V++++PTRELA+QI  EA KF   + ++   
Sbjct: 103 GSGKTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGI 162

Query: 134 IYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEP 193
           +YGG     Q   + RG  +VIATPGRL+D ++          ++VLDEADRMLDMGF  
Sbjct: 163 VYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSE 222

Query: 194 QIRKIVTQI--RPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLELKANQSINQVVE 251
            +R+I+T +  RP+ QTL +SAT+P E++ +A +FL+N   V IG +   A   + Q + 
Sbjct: 223 DMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVG-GACSDVKQTIY 281

Query: 252 VVTEAEKYNRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSER 311
            V +  K ++LI++L E       ++F ETK+G D +   L    +P  SIHGD+ QS+R
Sbjct: 282 EVNKYAKRSKLIEILSE--QADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQR 339

Query: 312 DWVLAEFRSGRSPIMTATDVAARGL 336
           +  L +F++G   ++ AT VA+RGL
Sbjct: 340 EQALRDFKNGSMKVLIATSVASRGL 364


>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Length = 510 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Length = 1054 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Length = 523 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query342
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 100.0
3bor_A237 Human initiation factor 4A-II; translation initiat 100.0
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 100.0
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 100.0
4gl2_A 699 Interferon-induced helicase C domain-containing P; 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 100.0
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 100.0
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 100.0
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 100.0
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 100.0
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 100.0
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 100.0
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 100.0
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 100.0
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 100.0
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 100.0
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 100.0
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 100.0
3h1t_A590 Type I site-specific restriction-modification syst 100.0
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.97
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.97
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.97
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.97
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.97
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.97
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.97
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.97
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.97
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.97
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.96
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.96
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.95
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 99.95
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.93
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.93
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.92
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.92
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.87
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.87
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.86
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.86
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.86
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.82
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.79
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.64
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.63
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.63
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.62
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.61
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.6
3eaq_A 212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.56
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.52
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.17
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.12
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.98
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 98.79
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 98.77
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 98.74
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.71
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 98.69
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 98.6
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 98.57
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 97.79
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 97.75
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.74
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.73
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 97.72
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.7
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 97.62
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.45
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 97.43
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 97.38
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 97.34
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 97.27
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.18
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.18
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 97.14
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 97.11
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 97.09
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 97.08
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 96.95
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.92
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 96.87
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.84
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.79
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.78
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.77
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 96.75
2v1u_A387 Cell division control protein 6 homolog; DNA repli 96.73
3co5_A143 Putative two-component system transcriptional RES 96.71
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.71
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 96.65
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.61
3bos_A242 Putative DNA replication factor; P-loop containing 96.6
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.42
2qgz_A308 Helicase loader, putative primosome component; str 96.39
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 96.29
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 96.27
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 96.14
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 96.1
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 96.08
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.07
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.06
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 96.05
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.96
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 95.94
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 95.88
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 95.87
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.75
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 95.68
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 95.65
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 95.64
2gno_A305 DNA polymerase III, gamma subunit-related protein; 95.63
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 95.62
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 95.62
3pvs_A 447 Replication-associated recombination protein A; ma 95.5
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 95.49
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 95.25
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 95.19
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 94.97
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 94.97
3hjh_A483 Transcription-repair-coupling factor; MFD, mutatio 94.94
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 94.8
2r6a_A454 DNAB helicase, replicative helicase; replication, 94.7
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 94.66
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 94.56
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 94.53
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 94.44
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 94.3
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 94.03
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 94.03
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 94.0
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 93.93
2fna_A357 Conserved hypothetical protein; structural genomic 93.89
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 93.83
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 93.74
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 93.71
3hgt_A 328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 93.6
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 93.35
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 93.26
2l8b_A189 Protein TRAI, DNA helicase I; RECD, hydrolase; NMR 93.17
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 92.94
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 92.68
2oap_1511 GSPE-2, type II secretion system protein; hexameri 92.61
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 92.44
1w36_B 1180 RECB, exodeoxyribonuclease V beta chain; recombina 92.34
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 92.23
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 92.13
3io5_A333 Recombination and repair protein; storage dimer, i 92.09
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 92.0
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 91.64
1p9r_A418 General secretion pathway protein E; bacterial typ 91.55
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 91.27
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 91.18
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 91.13
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 90.96
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 90.95
2l82_A162 Designed protein OR32; structural genomics, northe 90.8
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 90.63
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 90.38
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 90.05
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 89.86
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 89.86
1tue_A212 Replication protein E1; helicase, replication, E1E 89.85
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 89.58
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 89.51
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 89.46
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 89.46
3vaa_A199 Shikimate kinase, SK; structural genomics, center 89.31
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 89.29
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 89.27
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 89.23
2eyu_A261 Twitching motility protein PILT; pilus retraction 89.16
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 89.08
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 88.92
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 88.82
2r44_A331 Uncharacterized protein; putative ATPase, structur 88.81
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 88.8
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 88.76
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 88.68
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 88.65
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 88.55
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 88.52
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 88.4
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 88.39
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 88.35
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 88.34
3u4q_B 1166 ATP-dependent helicase/deoxyribonuclease subunit; 88.26
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 88.26
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 88.16
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 88.1
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 88.05
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 87.97
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 87.86
1kag_A173 SKI, shikimate kinase I; transferase, structural g 87.81
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 87.67
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 87.3
1u94_A356 RECA protein, recombinase A; homologous recombinat 87.28
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 87.2
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 87.12
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 87.0
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 86.99
2cvh_A220 DNA repair and recombination protein RADB; filamen 86.97
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 86.95
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 86.94
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 86.9
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 86.9
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 86.81
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 86.8
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 86.68
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 86.63
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 86.59
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 86.58
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 86.57
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 86.51
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 86.47
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 86.33
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 86.32
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 86.31
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 86.22
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 86.12
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 86.12
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 86.09
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 86.07
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 85.98
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 85.94
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 85.82
2ewv_A372 Twitching motility protein PILT; pilus retraction 85.76
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 85.75
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 85.72
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 85.53
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 85.5
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 85.46
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 85.35
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 85.34
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 85.32
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 85.27
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 85.26
1ojl_A304 Transcriptional regulatory protein ZRAR; response 85.22
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 85.18
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 85.14
1vma_A306 Cell division protein FTSY; TM0570, structural gen 85.09
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 85.02
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 84.94
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 84.88
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 84.88
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 84.71
1xp8_A366 RECA protein, recombinase A; recombination, radior 84.64
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 84.62
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 84.62
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 84.59
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 84.54
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 84.49
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 84.44
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 84.24
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 84.24
2r62_A268 Cell division protease FTSH homolog; ATPase domain 84.17
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 83.8
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 83.77
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 83.68
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 83.6
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 83.49
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 83.48
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 83.43
2z43_A324 DNA repair and recombination protein RADA; archaea 83.42
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 83.37
2jtq_A85 Phage shock protein E; solution structure rhodanes 83.35
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 83.27
1yks_A440 Genome polyprotein [contains: flavivirin protease 83.26
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 83.26
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 83.18
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 83.15
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 83.0
3bor_A237 Human initiation factor 4A-II; translation initiat 82.94
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 82.89
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 82.8
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 82.77
3dmn_A174 Putative DNA helicase; APC89291.2, lactobacillus p 82.65
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 82.63
3foj_A100 Uncharacterized protein; protein SSP1007, structur 82.63
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 82.56
3nwn_A359 Kinesin-like protein KIF9; motor domain, ADP, stru 82.51
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 82.37
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 82.32
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 82.26
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 82.24
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 82.17
1xjc_A169 MOBB protein homolog; structural genomics, midwest 82.11
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 82.09
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 81.97
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 81.97
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 81.9
1via_A175 Shikimate kinase; structural genomics, transferase 81.74
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 81.66
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 81.6
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 81.44
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 81.41
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 81.33
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 81.31
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 81.29
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 81.28
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 81.25
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 81.22
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 81.1
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 81.1
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 81.04
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 80.88
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 80.85
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 80.84
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 80.84
3bs4_A260 Uncharacterized protein PH0321; structural genomic 80.44
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 80.31
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 80.23
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 80.14
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 80.11
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 80.11
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 80.08
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=1.6e-52  Score=375.38  Aligned_cols=326  Identities=40%  Similarity=0.664  Sum_probs=291.0

Q ss_pred             ceeeeccCCCccccccccCCCCHHHHHHHHHcCCCCCcHHHHhhHHHHhcCCCEEEEcCCCCchhhHhHHHHHHhhhcCC
Q 019337           14 EITVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQP   93 (342)
Q Consensus        14 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~Q~~~~~~~~~~~~~l~~~~tG~GKT~~~~~~~~~~~~~~~   93 (342)
                      .+.+.|...|.|...|+++++++.+.+++..+||..|+++|.++++.+++++++++++|||+|||++|+++++.++....
T Consensus        43 ~~~~~~~~~p~~~~~f~~~~l~~~l~~~l~~~g~~~pt~iQ~~ai~~i~~g~d~i~~a~TGsGKT~a~~lpil~~l~~~~  122 (434)
T 2db3_A           43 PVKVTGSDVPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDP  122 (434)
T ss_dssp             CEEEESSSCCCCCCCGGGSCCCHHHHHHHHHTTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHHHHHSC
T ss_pred             eeEecCCCCCCCcCChhhcCCCHHHHHHHHHcCCCCCCHHHHHHHHHHhcCCCEEEECCCCCCchHHHHHHHHHHHHhcc
Confidence            56778889999999999999999999999999999999999999999999999999999999999999999999887654


Q ss_pred             CccCCCCceEEEEcCcHHHHHHHHHHHHHhcCCCCeEEEEEecCCcchhhHHhhcCCCcEEEeChHHHHHHHhccccCCC
Q 019337           94 RLVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLR  173 (342)
Q Consensus        94 ~~~~~~~~~vlil~p~~~l~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iiv~T~~~l~~~~~~~~~~~~  173 (342)
                      ......++++||++|+++|+.|+.+.+++++...++.+..++|+.........+..+++|+|+||++|.+++......+.
T Consensus       123 ~~~~~~~~~~lil~PtreLa~Q~~~~~~~~~~~~~~~~~~~~gg~~~~~~~~~l~~~~~Ivv~Tp~~l~~~l~~~~~~l~  202 (434)
T 2db3_A          123 HELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFE  202 (434)
T ss_dssp             CCCCTTCCSEEEECSSHHHHHHHHHHHHHHTTTSSCCCCEECTTSCHHHHHHHHTTCCSEEEECHHHHHHHHHTTSCCCT
T ss_pred             cccccCCccEEEEecCHHHHHHHHHHHHHHhccCCcEEEEEECCCCHHHHHHHhhcCCCEEEEChHHHHHHHHhCCcccc
Confidence            33333477999999999999999999999998888999999999888777777778899999999999999988877889


Q ss_pred             CccEEEEeccchhhcCCChHHHHHHHhhc--CCCccEEEEEeecCchHHHHHHHhcCCCeEEEecccccccccccceEEE
Q 019337          174 RVTYLVLDEADRMLDMGFEPQIRKIVTQI--RPDRQTLYWSATWPREVETLARQFLRNPYKVIIGSLELKANQSINQVVE  251 (342)
Q Consensus       174 ~~~~iIvDE~h~~~~~~~~~~~~~~~~~~--~~~~~~i~~SaT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  251 (342)
                      .++++|+||||++.+.+|...+..++..+  ++..|++++|||++..+..+...++.++..+...... .....+...+.
T Consensus       203 ~~~~lVlDEah~~~~~gf~~~~~~i~~~~~~~~~~q~l~~SAT~~~~~~~~~~~~l~~~~~i~~~~~~-~~~~~i~~~~~  281 (434)
T 2db3_A          203 DTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVG-GACSDVKQTIY  281 (434)
T ss_dssp             TCCEEEEETHHHHTSTTTHHHHHHHHHCTTSCSSCEEEEEESCCCHHHHHHHHTTCSSCEEEEESSTT-CCCTTEEEEEE
T ss_pred             cCCeEEEccHhhhhccCcHHHHHHHHHhcCCCCCceEEEEeccCCHHHHHHHHHhccCCEEEEecccc-ccccccceEEE
Confidence            99999999999999999999999998875  5678999999999999999999999888877765443 23344555666


Q ss_pred             EechhhHHHHHHHHHHhhcCCCcEEEEeCCchhHHHHHHHHHhCCCCcEeecCCCCHHHHHHHHHHHhcCCCCEEEEecc
Q 019337          252 VVTEAEKYNRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFRSGRSPIMTATDV  331 (342)
Q Consensus       252 ~~~~~~~~~~l~~~l~~~~~~~~~lvf~~~~~~~~~l~~~L~~~~~~~~~~~~~~~~~~r~~~~~~f~~~~~~vlv~t~~  331 (342)
                      ......+...+.+.+.+.  ..++||||+++++++.+++.|.+.++++..+||++++.+|..+++.|++|+.+|||||++
T Consensus       282 ~~~~~~k~~~l~~~l~~~--~~~~lVF~~t~~~a~~l~~~L~~~~~~~~~lhg~~~~~~R~~~l~~F~~g~~~vLvaT~v  359 (434)
T 2db3_A          282 EVNKYAKRSKLIEILSEQ--ADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSV  359 (434)
T ss_dssp             ECCGGGHHHHHHHHHHHC--CTTEEEECSSHHHHHHHHHHHHHTTCCEEEESTTSCHHHHHHHHHHHHTSSCSEEEECGG
T ss_pred             EeCcHHHHHHHHHHHHhC--CCCEEEEEeCcHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHHHcCCCcEEEEchh
Confidence            677778888888888774  345999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCCCCCCCC
Q 019337          332 AARGLGRITVC  342 (342)
Q Consensus       332 ~~~Gidip~v~  342 (342)
                      +++|+|+|+|+
T Consensus       360 ~~rGlDi~~v~  370 (434)
T 2db3_A          360 ASRGLDIKNIK  370 (434)
T ss_dssp             GTSSCCCTTCC
T ss_pred             hhCCCCcccCC
Confidence            99999999975



>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2l82_A Designed protein OR32; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3dmn_A Putative DNA helicase; APC89291.2, lactobacillus plantarum WCFS1, STR genomics, PSI-2, midwest center for structural genomics; HET: MSE; 1.66A {Lactobacillus plantarum} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 342
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 8e-56
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 3e-52
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 7e-51
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 2e-50
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 1e-48
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 3e-44
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 2e-43
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 4e-41
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 4e-36
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 5e-36
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 6e-31
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 2e-27
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 6e-26
d1a1va2 299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 4e-18
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 2e-17
d1gkub2 248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 3e-15
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 3e-11
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 3e-10
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 1e-09
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 3e-09
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 6e-08
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 6e-08
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 1e-07
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 1e-06
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 7e-06
d1s2ma2171 c.37.1.19 (A:252-422) Putative ATP-dependent RNA h 3e-04
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 8e-04
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 0.001
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative DEAD box RNA helicase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]
 Score =  179 bits (454), Expect = 8e-56
 Identities = 75/206 (36%), Positives = 112/206 (54%), Gaps = 8/206 (3%)

Query: 29  FQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGR-DLIGIAETGSGKTLSYLLPAFV 87
           F E N  D  L  I   GF +PT IQ +  P+ L    +++  A TGSGKT S+ +P   
Sbjct: 6   FNELNLSDNILNAIRNKGFEKPTDIQMKVIPLFLNDEYNIVAQARTGSGKTASFAIPLIE 65

Query: 88  HVSAQPRLVQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTCIYGGAPKGPQIRDL 147
            V+         G   ++L PTRELA+Q+ +E         ++   IYGG    PQI+ L
Sbjct: 66  LVNENN------GIEAIILTPTRELAIQVADEIESLKGNKNLKIAKIYGGKAIYPQIKAL 119

Query: 148 RRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVTQIRPDRQ 207
           +    IV+ TPGR++D +     NL+ V Y +LDEAD ML+MGF   + KI+     D++
Sbjct: 120 K-NANIVVGTPGRILDHINRGTLNLKNVKYFILDEADEMLNMGFIKDVEKILNACNKDKR 178

Query: 208 TLYWSATWPREVETLARQFLRNPYKV 233
            L +SAT PRE+  LA++++ +   +
Sbjct: 179 ILLFSATMPREILNLAKKYMGDYSFI 204


>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query342
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 100.0
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 100.0
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 100.0
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 100.0
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.96
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.95
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.95
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.94
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.94
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.9
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.87
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.86
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.86
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.81
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.77
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.77
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.71
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.68
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.68
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.68
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.66
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.65
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.65
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.64
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.61
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.61
d2eyqa5 211 Transcription-repair coupling factor, TRCF {Escher 99.42
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.26
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.26
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.23
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.23
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 99.22
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 99.19
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.19
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 99.15
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 98.79
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 98.74
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 98.71
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.69
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.66
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.59
d1nkta4 219 Translocation ATPase SecA, nucleotide-binding doma 98.24
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 98.2
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 97.99
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 97.78
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 97.62
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.54
d2qy9a2211 GTPase domain of the signal recognition particle r 97.43
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.4
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 97.37
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 97.36
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 97.22
d1vmaa2213 GTPase domain of the signal recognition particle r 97.17
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.15
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 97.09
d1okkd2207 GTPase domain of the signal recognition particle r 97.05
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 97.05
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 97.04
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 97.04
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 97.03
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.96
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.8
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.71
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.7
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.28
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.17
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.02
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 95.89
d1c4oa1 408 Nucleotide excision repair enzyme UvrB {Thermus th 95.81
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 95.68
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 95.54
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 95.48
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 95.47
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 95.39
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 95.28
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 95.15
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 95.03
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 94.51
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 94.23
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.08
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 94.07
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 93.74
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 93.7
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 93.4
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 93.37
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 93.16
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 93.05
d2hyda1255 Putative multidrug export ATP-binding/permease pro 92.94
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 92.31
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 92.16
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 92.14
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 92.09
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 91.96
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 91.91
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 91.83
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 91.7
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 91.61
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 91.42
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 91.33
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 91.22
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 91.15
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 90.99
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 90.89
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 90.87
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 90.87
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 90.85
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 90.81
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 90.34
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 90.1
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 90.1
d2eyqa2117 Transcription-repair coupling factor, TRCF {Escher 89.77
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 89.72
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 89.56
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 89.54
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 89.24
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 89.22
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 89.07
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 88.98
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 88.98
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 88.74
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 88.69
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 88.67
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 88.65
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 88.44
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 88.38
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 88.32
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 88.11
d1svma_362 Papillomavirus large T antigen helicase domain {Si 88.04
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 88.03
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 87.98
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 87.93
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 87.92
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 87.86
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 87.76
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 87.17
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 86.97
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 86.82
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 86.79
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 86.62
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 86.56
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 86.46
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 86.45
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 86.18
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 86.09
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 86.03
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 85.85
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 85.65
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 85.61
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 85.57
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 85.55
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 85.51
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 85.24
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 85.03
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 83.99
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 83.85
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 83.61
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 83.27
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 83.23
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 82.99
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 82.7
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 82.55
d1bg2a_323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 82.37
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 82.33
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 81.16
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 81.09
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 80.97
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 80.86
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 80.84
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 80.67
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 80.6
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 80.38
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 80.17
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 80.15
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 80.14
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.2e-40  Score=265.18  Aligned_cols=215  Identities=33%  Similarity=0.564  Sum_probs=197.8

Q ss_pred             eeeccCCCccccccccCCCCHHHHHHHHHcCCCCCcHHHHhhHHHHhcCCCEEEEcCCCCchhhHhHHHHHHhhhcCCCc
Q 019337           16 TVEGHDVPRPIRIFQEANFPDYCLEVIAKLGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLSYLLPAFVHVSAQPRL   95 (342)
Q Consensus        16 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~Q~~~~~~~~~~~~~l~~~~tG~GKT~~~~~~~~~~~~~~~~~   95 (342)
                      ..+..........|+++++++.+.+++.+.||..|+++|..+++.+++|+|+++.+|||+|||++|+++++.++..... 
T Consensus         6 ~~~~~~~~~~~~sF~~l~L~~~l~~~L~~~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~~~-   84 (222)
T d2j0sa1           6 EFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVR-   84 (222)
T ss_dssp             CCCCCTTCCCCCSGGGGCCCHHHHHHHHHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTTSC-
T ss_pred             ccccCCCCCCCCCHHHCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhhhccccccccccccc-
Confidence            3444555667778999999999999999999999999999999999999999999999999999999999998866543 


Q ss_pred             cCCCCceEEEEcCcHHHHHHHHHHHHHhcCCCCeEEEEEecCCcchhhHHhhcCCCcEEEeChHHHHHHHhccccCCCCc
Q 019337           96 VQGEGPIVLVLAPTRELAVQIQEEALKFGSRAGIRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRV  175 (342)
Q Consensus        96 ~~~~~~~vlil~p~~~l~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iiv~T~~~l~~~~~~~~~~~~~~  175 (342)
                          .++++|++|+++|+.|..+.+++++...++++..+.|+.........+..+++|+|+||+++.+++......+..+
T Consensus        85 ----~~~~lil~PtreLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~~~~~~~~~~l  160 (222)
T d2j0sa1          85 ----ETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAI  160 (222)
T ss_dssp             ----SCCEEEECSSHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHTTSSCCTTC
T ss_pred             ----CceeEEecchHHHHHHHHHHHHHHhCccceeEEEEeecccchhhHHHhccCCeEEeCCCCcHHhcccccccccccc
Confidence                6789999999999999999999999999999999999998888887777889999999999999999988889999


Q ss_pred             cEEEEeccchhhcCCChHHHHHHHhhcCCCccEEEEEeecCchHHHHHHHhcCCCeEEEe
Q 019337          176 TYLVLDEADRMLDMGFEPQIRKIVTQIRPDRQTLYWSATWPREVETLARQFLRNPYKVII  235 (342)
Q Consensus       176 ~~iIvDE~h~~~~~~~~~~~~~~~~~~~~~~~~i~~SaT~~~~~~~~~~~~~~~~~~~~~  235 (342)
                      .++|+||||.+++.+|...+..++..+++.+|.+++|||++..++.+++.++.+|..+.+
T Consensus       161 ~~lVlDEaD~ll~~~f~~~i~~I~~~l~~~~Q~ilfSAT~~~~v~~l~~~~l~~Pv~I~V  220 (222)
T d2j0sa1         161 KMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILV  220 (222)
T ss_dssp             CEEEEETHHHHTSTTTHHHHHHHHTTSCTTCEEEEEESCCCHHHHTTGGGTCSSCEEECC
T ss_pred             eeeeecchhHhhhcCcHHHHHHHHHhCCCCCEEEEEEEeCCHHHHHHHHHHCCCCEEEEE
Confidence            999999999999999999999999999999999999999999999999999999887654



>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2eyqa2 c.37.1.19 (A:349-465) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure