BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 019341
(342 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2E4O|A Chain A, X-Ray Crystal Structure Of Aristolochene Synthase From
Aspergillus Terreus And The Evolution Of Templates For
The Cyclization Of Farnesyl Diphosphate
pdb|2E4O|B Chain B, X-Ray Crystal Structure Of Aristolochene Synthase From
Aspergillus Terreus And The Evolution Of Templates For
The Cyclization Of Farnesyl Diphosphate
pdb|2E4O|C Chain C, X-Ray Crystal Structure Of Aristolochene Synthase From
Aspergillus Terreus And The Evolution Of Templates For
The Cyclization Of Farnesyl Diphosphate
pdb|2E4O|D Chain D, X-Ray Crystal Structure Of Aristolochene Synthase From
Aspergillus Terreus And The Evolution Of Templates For
The Cyclization Of Farnesyl Diphosphate
pdb|2OA6|A Chain A, Aristolochene Synthase From Aspergillus Terreus Complexed
With Pyrophosphate
pdb|2OA6|B Chain B, Aristolochene Synthase From Aspergillus Terreus Complexed
With Pyrophosphate
pdb|2OA6|C Chain C, Aristolochene Synthase From Aspergillus Terreus Complexed
With Pyrophosphate
pdb|2OA6|D Chain D, Aristolochene Synthase From Aspergillus Terreus Complexed
With Pyrophosphate
pdb|3BNX|A Chain A, Crystal Structure Of Aristolochene Synthase Complexed With
Farnesyl Diphosphate
pdb|3BNX|B Chain B, Crystal Structure Of Aristolochene Synthase Complexed With
Farnesyl Diphosphate
pdb|3BNX|C Chain C, Crystal Structure Of Aristolochene Synthase Complexed With
Farnesyl Diphosphate
pdb|3BNX|D Chain D, Crystal Structure Of Aristolochene Synthase Complexed With
Farnesyl Diphosphate
pdb|3BNY|A Chain A, Crystal Structure Of Aristolochene Synthase Complexed With
2-Fluorofarnesyl Diphosphate (2f-Fpp)
pdb|3BNY|B Chain B, Crystal Structure Of Aristolochene Synthase Complexed With
2-Fluorofarnesyl Diphosphate (2f-Fpp)
pdb|3BNY|C Chain C, Crystal Structure Of Aristolochene Synthase Complexed With
2-Fluorofarnesyl Diphosphate (2f-Fpp)
pdb|3BNY|D Chain D, Crystal Structure Of Aristolochene Synthase Complexed With
2-Fluorofarnesyl Diphosphate (2f-Fpp)
pdb|3CKE|A Chain A, Crystal Structure Of Aristolochene Synthase In Complex
With 12,13- Difluorofarnesyl Diphosphate
pdb|3CKE|B Chain B, Crystal Structure Of Aristolochene Synthase In Complex
With 12,13- Difluorofarnesyl Diphosphate
pdb|3CKE|C Chain C, Crystal Structure Of Aristolochene Synthase In Complex
With 12,13- Difluorofarnesyl Diphosphate
pdb|3CKE|D Chain D, Crystal Structure Of Aristolochene Synthase In Complex
With 12,13- Difluorofarnesyl Diphosphate
Length = 320
Score = 29.3 bits (64), Expect = 2.9, Method: Compositional matrix adjust.
Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 7/55 (12%)
Query: 162 DIWNDLEGHELMKIFELDNPVYLYTKKRTMET------VGRYLESRTNSYGMKEL 210
D+W + H+ E+ PV+L+ + +T T +G YLE R G KEL
Sbjct: 130 DLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVG-KEL 183
>pdb|2GSX|A Chain A, Complement Receptor Type 2
Length = 951
Score = 29.3 bits (64), Expect = 3.3, Method: Compositional matrix adjust.
Identities = 14/62 (22%), Positives = 26/62 (41%), Gaps = 2/62 (3%)
Query: 146 AQFLCDGTGSIWVEENDIWNDLEGHELMKIFELDNPV--YLYTKKRTMETVGRYLESRTN 203
F +G S+W + N++W + +F L+ P ++ T E VG +
Sbjct: 100 TNFSMNGNKSVWCQANNMWGPTRLPTCVSVFPLECPALPMIHNGHHTSENVGSIAPGLSV 159
Query: 204 SY 205
+Y
Sbjct: 160 TY 161
>pdb|2BUD|A Chain A, The Solution Structure Of The Chromo Barrel Domain From
The Males-Absent On The First (Mof) Protein
Length = 92
Score = 28.5 bits (62), Expect = 5.4, Method: Composition-based stats.
Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 6/67 (8%)
Query: 172 LMKIFELDNPVYLYTKKRTMETV--GRYLESRTNSYGMKELKCPELLAEHYKPLSCRIHQ 229
+ KI +NP +Y +R TV G+ L+SRT + P+ HY L+ R+
Sbjct: 8 MQKIDISENPDKIYFIRREDGTVHRGQVLQSRTT----ENAAAPDEYYVHYVGLNRRLDG 63
Query: 230 WVSTHAL 236
WV H +
Sbjct: 64 WVGRHRI 70
>pdb|1S57|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From
Arabidopsis
pdb|1S57|B Chain B, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From
Arabidopsis
pdb|1S57|C Chain C, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From
Arabidopsis
pdb|1S57|D Chain D, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From
Arabidopsis
pdb|1S57|E Chain E, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From
Arabidopsis
pdb|1S57|F Chain F, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From
Arabidopsis
pdb|1S59|A Chain A, Structure Of Nucleoside Diphosphate Kinase 2 With Bound
Dgtp From Arabidopsis
pdb|1S59|B Chain B, Structure Of Nucleoside Diphosphate Kinase 2 With Bound
Dgtp From Arabidopsis
pdb|1S59|C Chain C, Structure Of Nucleoside Diphosphate Kinase 2 With Bound
Dgtp From Arabidopsis
pdb|1S59|D Chain D, Structure Of Nucleoside Diphosphate Kinase 2 With Bound
Dgtp From Arabidopsis
pdb|1S59|E Chain E, Structure Of Nucleoside Diphosphate Kinase 2 With Bound
Dgtp From Arabidopsis
pdb|1S59|F Chain F, Structure Of Nucleoside Diphosphate Kinase 2 With Bound
Dgtp From Arabidopsis
Length = 153
Score = 28.1 bits (61), Expect = 7.2, Method: Compositional matrix adjust.
Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%)
Query: 192 ETVGRYLESRTNSYGMKELKCP-ELLAEHYKPLSCR 226
E + R+ + G+K +CP EL EHYK LS +
Sbjct: 24 EIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAK 59
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.138 0.452
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,874,893
Number of Sequences: 62578
Number of extensions: 403731
Number of successful extensions: 818
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 817
Number of HSP's gapped (non-prelim): 7
length of query: 342
length of database: 14,973,337
effective HSP length: 100
effective length of query: 242
effective length of database: 8,715,537
effective search space: 2109159954
effective search space used: 2109159954
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (24.6 bits)