BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 019357
         (342 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3FSL|A Chain A, Crystal Structure Of Tyrosine Aminotransferase Tripple
           Mutant (P181q, R183g,A321k) From Escherichia Coli At
           2.35 A Resolution
 pdb|3FSL|B Chain B, Crystal Structure Of Tyrosine Aminotransferase Tripple
           Mutant (P181q, R183g,A321k) From Escherichia Coli At
           2.35 A Resolution
 pdb|3FSL|C Chain C, Crystal Structure Of Tyrosine Aminotransferase Tripple
           Mutant (P181q, R183g,A321k) From Escherichia Coli At
           2.35 A Resolution
 pdb|3FSL|D Chain D, Crystal Structure Of Tyrosine Aminotransferase Tripple
           Mutant (P181q, R183g,A321k) From Escherichia Coli At
           2.35 A Resolution
 pdb|3FSL|E Chain E, Crystal Structure Of Tyrosine Aminotransferase Tripple
           Mutant (P181q, R183g,A321k) From Escherichia Coli At
           2.35 A Resolution
 pdb|3FSL|F Chain F, Crystal Structure Of Tyrosine Aminotransferase Tripple
           Mutant (P181q, R183g,A321k) From Escherichia Coli At
           2.35 A Resolution
          Length = 397

 Score = 28.9 bits (63), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 47/105 (44%), Gaps = 7/105 (6%)

Query: 228 WFNFVSKLFPKQDLVATLKKMAMGQTIYGPIMTVVFLSLNASLQGESGEEIVARLK-RDL 286
           W++  +      DL+ATLK +  G  +   +         A L  +  + ++  LK R+L
Sbjct: 150 WYDEATNGVRFNDLLATLKTLQAGSIVL--LHPCCHNPTGADLTNDQWDAVIEILKAREL 207

Query: 287 LPTM---FKGVMYWPVCDFITFR-FTPVHLQPLVSNSFSYLWTIY 327
           +P +   ++G       D    R      L  LVSNSFS ++++Y
Sbjct: 208 IPFLDIAYQGFGAGMEEDAYAIRAIASAGLPALVSNSFSKIFSLY 252


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.132    0.385 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,655,624
Number of Sequences: 62578
Number of extensions: 308459
Number of successful extensions: 791
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 791
Number of HSP's gapped (non-prelim): 3
length of query: 342
length of database: 14,973,337
effective HSP length: 100
effective length of query: 242
effective length of database: 8,715,537
effective search space: 2109159954
effective search space used: 2109159954
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)