BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 019357
(342 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3FSL|A Chain A, Crystal Structure Of Tyrosine Aminotransferase Tripple
Mutant (P181q, R183g,A321k) From Escherichia Coli At
2.35 A Resolution
pdb|3FSL|B Chain B, Crystal Structure Of Tyrosine Aminotransferase Tripple
Mutant (P181q, R183g,A321k) From Escherichia Coli At
2.35 A Resolution
pdb|3FSL|C Chain C, Crystal Structure Of Tyrosine Aminotransferase Tripple
Mutant (P181q, R183g,A321k) From Escherichia Coli At
2.35 A Resolution
pdb|3FSL|D Chain D, Crystal Structure Of Tyrosine Aminotransferase Tripple
Mutant (P181q, R183g,A321k) From Escherichia Coli At
2.35 A Resolution
pdb|3FSL|E Chain E, Crystal Structure Of Tyrosine Aminotransferase Tripple
Mutant (P181q, R183g,A321k) From Escherichia Coli At
2.35 A Resolution
pdb|3FSL|F Chain F, Crystal Structure Of Tyrosine Aminotransferase Tripple
Mutant (P181q, R183g,A321k) From Escherichia Coli At
2.35 A Resolution
Length = 397
Score = 28.9 bits (63), Expect = 4.1, Method: Compositional matrix adjust.
Identities = 27/105 (25%), Positives = 47/105 (44%), Gaps = 7/105 (6%)
Query: 228 WFNFVSKLFPKQDLVATLKKMAMGQTIYGPIMTVVFLSLNASLQGESGEEIVARLK-RDL 286
W++ + DL+ATLK + G + + A L + + ++ LK R+L
Sbjct: 150 WYDEATNGVRFNDLLATLKTLQAGSIVL--LHPCCHNPTGADLTNDQWDAVIEILKAREL 207
Query: 287 LPTM---FKGVMYWPVCDFITFR-FTPVHLQPLVSNSFSYLWTIY 327
+P + ++G D R L LVSNSFS ++++Y
Sbjct: 208 IPFLDIAYQGFGAGMEEDAYAIRAIASAGLPALVSNSFSKIFSLY 252
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.132 0.385
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,655,624
Number of Sequences: 62578
Number of extensions: 308459
Number of successful extensions: 791
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 791
Number of HSP's gapped (non-prelim): 3
length of query: 342
length of database: 14,973,337
effective HSP length: 100
effective length of query: 242
effective length of database: 8,715,537
effective search space: 2109159954
effective search space used: 2109159954
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)