Citrus Sinensis ID: 019368


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340--
MAGTVKRIKLGSQGLEVSAQGLGCMAMSCLYGPPEPEPDMIALIHHAINSGITLLDTSDIYGPYTNEILVGKALKGGMRERVELATKFGISFADGGKIRGDPAYVRACCEASLKRLDIDCIDLYYQHRVDTKIPIEVTIGELKKLVEEGKIKYIGLSEACAATIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGIVAYGPLGQGFLSSGPKLVESFSKYDFRKCMPKFQAENLEHNKKLFERVNEIAMRKGCTPAQLALAWVHHQGDDVCPIPGTTKIEQLNENIQALSVKLAPEEMAELDSIASADAVKGDRYPDGVTTYKDSDTPPLSSWRPS
ccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHcccccccEEEEEEcccEEcccccccccHHHHHHHHHHHHHHHccccEEccccccccccccHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHccccccHHHHHHHHcccccHHHHHHHHHHHccCEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccCECcccccccccHHHHHccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccc
****VKR*KLGSQGLEVSAQGLGCMAMSCLYGPPEPEPDMIALIHHAINSGITLLDTSDIYGPYTNEILVGKALKGGMRERVELATKFGISFADGGKIRGDPAYVRACCEASLKRLDIDCIDLYYQHRVDTKIPIEVTIGELKKLVEEGKIKYIGLSEACAATIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGIVAYGPLGQGFLSSGPKLVESFSKYDFRKCMPKFQAENLEHNKKLFERVNEIAMRKGCTPAQLALAWVHHQGDDVCPIPGTTKIEQLNENIQALSVKLAPEEMAELDSIASADAVKGDRYPDGVTTYKDS***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGTVKRIKLGSQGLEVSAQGLGCMAMSCLYGPPEPEPDMIALIHHAINSGITLLDTSDIYGPYTNEILVGKALKGGMRERVELATKFGISFADGGKIRGDPAYVRACCEASLKRLDIDCIDLYYQHRVDTKIPIEVTIGELKKLVEEGKIKYIGLSEACAATIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGIVAYGPLGQGFLSSGPKLVESFSKYDFRKCMPKFQxxxxxxxxxxxxxxxxxxxxxGCTPAQLALAWVHHQGDDVCPIPGTTKIEQLNENIQALSVKLAPEEMAELDSIASADAVKGDRYPDGVTTYKDSDTPPLSSWRPS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable aldo-keto reductase 3 confidentO22707
Probable aldo-keto reductase 2 confidentQ7XT99
Auxin-induced protein PCNT115 probableP40691

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3V0S, chain A
Confidence level:very confident
Coverage over the Query: 5-221,247-312,328-336
View the alignment between query and template
View the model in PyMOL