Citrus Sinensis ID: 019372


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340--
MPNKKESDTTVSSLPSDESNPTISSTIASTEHSKGNKPLSSAPVQIPISYPEDGMLTVEWIQDLTLTFDWSSRNLPPSEFPSVFPVDVFDTLVLTASKILHKEPNCVVIDDFDQDSRVVVVGDVHGQLHDVLFLLRDAGFPSKNCFFVFNGDYVDRGAWGLETFLLLLAWKVFLPHRVYLLRGNHESKYCTSVYGFEKEVMAKYGDKGKHAYRKCLGCFEGLPLASLIGKHVFTAHGGLFRSVSHAPSKKPKGKKKNNVVFNPETNPLSLGSFHELAKARRSVLDPPWNPQLSSNLIPGDLLWSDPSMKLGLSENTERGIGLLWGPDSTEEFLKKFSLKVIS
cccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHccccEEECccccccccEEEEEcccccHHHHHHHHHHccccccccccEEccccccccccHHHHHHHHHHHHHHccccEEEcccccccccccccccHHHHHHHHccccHHHHHHHHHHccccccHHHHccccEEEECccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEECcHHHHHHHHHHccccccc
************************************************SYPEDGMLTVEWIQDLTLTFDWSSRNLPPSEFPSVFPVDVFDTLVLTASKILHKEPNCVVIDDFDQDSRVVVVGDVHGQLHDVLFLLRDAGFPSKNCFFVFNGDYVDRGAWGLETFLLLLAWKVFLPHRVYLLRGNHESKYCTSVYGFEKEVMAKYGDKGKHAYRKCLGCFEGLPLASLIGKHVFTAHGGLFRSVSHAPSKKPKGKKKNNVVFNPETNPLSLGSFHELAKA************LSSNLIPGDLLWSDPSMKLGLSENTERGIGLLWGPDSTEEFLKKFSLKVIS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPNKKESDTTVSSLPSDESNPTISSTIASTEHSKGNKPLSSAPVQIPISYPEDGMLTVEWIQDLTLTFDWSSRNLPPSEFPSVFPVDVFDTLVLTASKILHKEPNCVVIDDFDQDSRVVVVGDVHGQLHDVLFLLRDAGFPSKNCFFVFNGDYVDRGAWGLETFLLLLAWKVFLPHRVYLLRGNHESKYCTSVYGFEKEVMAKYGDKGKHAYRKCLGCFEGLPLASLIGKHVFTAHGGLFRSVSHAPSKKPKGKKKNNVVFNPETNPLSLGSFHELAKARRSVLDPPWNPQLSSNLIPGDLLWSDPSMKLGLSENTERGIGLLWGPDSTEEFLKKFSLKVIS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein phosphatase 7 Phosphatase active on para-nitrophenylphosphate (pNPP) and on various phosphoproteins such as myelin basic protein. Seems to act as a positive regulator of cryptochrome signaling involved in hypocotyl growth inhibition and cotyledon expansion under white and blue light conditions. Confers thermotolerance. Required for heat shock mediated-signaling pathway that leads to the expression of heat shock proteins (HSPs).probableQ9FN02

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.16Phosphoprotein phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1AUI, chain A
Confidence level:very confident
Coverage over the Query: 61-71,82-243,271-342
View the alignment between query and template
View the model in PyMOL
Template: 3H60, chain A
Confidence level:confident
Coverage over the Query: 52-81,93-242,266-341
View the alignment between query and template
View the model in PyMOL