Citrus Sinensis ID: 019381


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340--
MEQQRNQKTVQQQQQEELEEIQHGPFPVEQLQASGIAALDVKKLKDAGLCTVESVAYSPRKELLQIKGISEAKVDKIIEAASKLVPLGFTSATQLHAQRLEIIQITSGSRELDKILEGGVETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRYGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERICKVISSPCLAEAEARFQISAQGVADVKD
ccHHHHHHHHHHHHHHHHHHHccccccccHHHHccccHHHHHHHHHcccccHHHHHcccHHHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHHHHcccEEEEcccHHHHHHHccccccccEEEEEccccccccHHHHHHHHHHcccccccccccEEEEEEccccccHHHHHHHHHHccccHHHHHccEEEEEEccHHHHHHHHHHHHHHHHHccEEEEEEEEEEEEEEECccccccHHHHHHHHHHHHHHHHHHHHHHccEEEEEcEEEECcccccccccccccccccccccccccEEEEEECccccCEEEEEECccccccEEEEEEEEccccccccc
*************************FPVEQLQASGIAALDVKKLKDAGLCTVESVAYSPRKELLQIKGISEAKVDKIIEAASKLVPLGFTSATQLHAQRLEIIQITSGSRELDKILEGGVETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRYGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERICKVISSPCLAEAEARFQISAQGV*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxQHGPFPVEQLQASGIAALDVKKLKDAGLCTVESVAYSPRKELLQIKGISEAKVDKIIEAASKLVPLGFTSATQLHAQRLEIIQITSGSRELDKILEGGVETGSITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRYGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAIFAGPQIKPIGGNIMAHASTTRLALRKGRGEERICKVISSPCLAEAEARFQISAQGVADVKD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA repair protein RAD51 homolog A Binds to single and double stranded DNA and exhibits DNA-dependent ATPase activity. Unwinds duplex DNA (By similarity). Component of the meiotic recombination pathway. Seems to play a role in mediating chromosome homology search, chromosome pairing and synapsis at early stages and probably chromosome crossing-over at later stages in meiosis. Probably is involved in the repair of meiotic double strand breaks (DBSs) and in homologous recombination.confidentQ67EU8
DNA repair protein RAD51 homolog Binds to single and double stranded DNA and exhibits DNA-dependent ATPase activity. Underwinds duplex DNA.confidentQ40134
DNA repair protein RAD51 homolog 1 Participates in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. Binds to single and double stranded DNA and exhibits DNA-dependent ATPase activity. Underwinds duplex DNA and forms helical nucleoprotein filaments. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51C and XRCC3.confidentQ06609

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CMU, chain A
Confidence level:very confident
Coverage over the Query: 69-339
View the alignment between query and template
View the model in PyMOL
Template: 3LDA, chain A
Confidence level:very confident
Coverage over the Query: 23-272,293-341
View the alignment between query and template
View the model in PyMOL