BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 019382
         (342 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2A0S|A Chain A, Crystal Structure Of 6-Pyruvoyl Tetrahydropterin Synthase
           (Ptps) From Plasmodium Vivax At 2.2 A Resolution
 pdb|2A0S|B Chain B, Crystal Structure Of 6-Pyruvoyl Tetrahydropterin Synthase
           (Ptps) From Plasmodium Vivax At 2.2 A Resolution
 pdb|3LX3|A Chain A, Plasmodium Vivax 6-Pyruvoyltetrahydropterin Synthase
           (Ptps) In Complex With Xanthopterin
          Length = 180

 Score = 28.5 bits (62), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%)

Query: 217 RDEAARVMVAAPLIAFVTTH-ILYLNFYKLDHGLNMKVCLAM 257
           RD+ A ++V +PL +F   H I +  F +  HG N  V L +
Sbjct: 17  RDQIAELLVESPLFSFNCAHFIAFKGFRETLHGHNYNVSLRL 58


>pdb|2LT8|A Chain A, Eurocin Solution Structure
          Length = 42

 Score = 27.7 bits (60), Expect = 9.3,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 5/34 (14%)

Query: 42 GCVGD--KCFQHCNFSSDGKP---IDGPWYLQEP 70
          GC GD  +C +HC     G+      GPWYL  P
Sbjct: 3  GCPGDAYQCSEHCRALGGGRTGGYCAGPWYLGHP 36


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.141    0.482 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,934,493
Number of Sequences: 62578
Number of extensions: 460831
Number of successful extensions: 1213
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 1213
Number of HSP's gapped (non-prelim): 3
length of query: 342
length of database: 14,973,337
effective HSP length: 100
effective length of query: 242
effective length of database: 8,715,537
effective search space: 2109159954
effective search space used: 2109159954
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 52 (24.6 bits)