BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 019393
         (341 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4ITR|A Chain A, Crystal Structure Of Ibpafic2-h3717a In Complex With
           Adenylylated Cdc42
 pdb|4ITR|B Chain B, Crystal Structure Of Ibpafic2-h3717a In Complex With
           Adenylylated Cdc42
          Length = 316

 Score = 27.7 bits (60), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 12/64 (18%)

Query: 14  EIENGLKLVPRMKL-------TLTINPATPSATKPID-----EWQLKRALTDFLKTSLSV 61
           EI++ +K +P+ K+       T  I  A  + +K I      + QLK A+ DFL+ S   
Sbjct: 98  EIQDLVKTLPKTKVIEDLSTKTNEITEALAATSKTIQRTPELKEQLKTAIEDFLQNSQGK 157

Query: 62  PITV 65
           P+TV
Sbjct: 158 PLTV 161


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.134    0.397 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,381,500
Number of Sequences: 62578
Number of extensions: 357350
Number of successful extensions: 788
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 787
Number of HSP's gapped (non-prelim): 9
length of query: 341
length of database: 14,973,337
effective HSP length: 100
effective length of query: 241
effective length of database: 8,715,537
effective search space: 2100444417
effective search space used: 2100444417
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)