BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 019432
         (341 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|B7IIB7|Y4423_BACC2 UPF0754 membrane protein BCG9842_B4423 OS=Bacillus cereus (strain
           G9842) GN=BCG9842_B4423 PE=3 SV=1
          Length = 378

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 5/73 (6%)

Query: 34  QAVNLTFTGKL-VFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVS 92
           Q +    T K+  F A +Y +T    W    P+ V  +V + +  +S F+LE+G   F S
Sbjct: 124 QKIEYVITEKIQAFLAEYYTYT----WEQALPHSVNEKVENAIPNVSAFILERGISFFES 179

Query: 93  EFGADLRGNNVND 105
           E G       ++D
Sbjct: 180 EEGKGRLSKMIDD 192


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.322    0.138    0.456 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 136,240,412
Number of Sequences: 539616
Number of extensions: 5925552
Number of successful extensions: 10910
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 10908
Number of HSP's gapped (non-prelim): 4
length of query: 341
length of database: 191,569,459
effective HSP length: 118
effective length of query: 223
effective length of database: 127,894,771
effective search space: 28520533933
effective search space used: 28520533933
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)