BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 019467
         (340 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1W61|A Chain A, Proline Racemase In Complex With 2 Molecules Of Pyrrole-2-
           Carboxylic Acid (Holo Form)
 pdb|1W61|B Chain B, Proline Racemase In Complex With 2 Molecules Of Pyrrole-2-
           Carboxylic Acid (Holo Form)
 pdb|1W62|A Chain A, Proline Racemase In Complex With One Molecule Of
           Pyrrole-2- Carboxylic Acid (hemi Form)
 pdb|1W62|B Chain B, Proline Racemase In Complex With One Molecule Of
           Pyrrole-2- Carboxylic Acid (hemi Form)
          Length = 414

 Score = 28.9 bits (63), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 4/64 (6%)

Query: 231 NKAAELFYSKLLAEVKNLNSSLPQAKIVY-VDFYNPLLDL---ISNPVKSGFSVSDRSCC 286
            +A EL  +++   VK  +  LP    V  V+ Y P  +      N V  G   +DRS C
Sbjct: 241 QEAGELLRTEINRSVKVQHPQLPHINTVDCVEIYGPPTNPEANYKNVVIFGNRQADRSPC 300

Query: 287 GTGT 290
           GTGT
Sbjct: 301 GTGT 304


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.137    0.402 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,235,957
Number of Sequences: 62578
Number of extensions: 436199
Number of successful extensions: 891
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 890
Number of HSP's gapped (non-prelim): 6
length of query: 340
length of database: 14,973,337
effective HSP length: 99
effective length of query: 241
effective length of database: 8,778,115
effective search space: 2115525715
effective search space used: 2115525715
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)