Citrus Sinensis ID: 019540


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MKRSLCSSDDSLGALMSICPATDEQSPRNNQVYSREFQTMLDGLDEEGCLEESGGHVSEKKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANYDALKLNYDSLQHDNEALLKEIRELKSKLNEENTESNISVKQEETIVHETDHQNKATLDRDQESDDKQAAAVAPPTNVTAISLAPAGNISDEPDQELNYDNGVLGISLFPDLKDGSSDSDSSAILNNEDNNNFHNSNNSHSPNAAISSSDGVIIQSQPHQLSINCFEFSKPTYQTHLSRWKSTISLVMRPAISSLMSSLLLFHGIVLISGPS
ccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccHHHHHHHHHHcHHcccccHHHHHHHHHHHcccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccc
*****************************************************************VDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANYDALKLNYDSLQHD************************************************************************************YDNGVLGISLF*******************************************IIQSQPHQLSINCFEFSKPTYQTHLSRWKSTISLVMRPAISSLMSSLLLFHGIVLI****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRSLCSSDDSLGALMSICPATDEQSPRNNQVYSREFQTMLDGLDEEGCLEESGGHVSEKKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSNISVKQEETIVHETDHQNKATLDRDQESDDKQAAAVAPPTNVTAISLAPAGNISDEPDQELNYDNGVLGISLFPDLKDGSSDSDSSAILNNEDNNNFHNSNNSHSPNAAISSSDGVIIQSQPHQLSINCFEFSKPTYQTHLSRWKSTISLVMRPAISSLMSSLLLFHGIVLISGPS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Homeobox-leucine zipper protein ATHB-16 Probable transcription factor that may function as a negative regulator of the flowering time response to photoperiod. May act to repress cell expansion during plant development.probableQ940J1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B72, chain A
Confidence level:very confident
Coverage over the Query: 60-117
View the alignment between query and template
View the model in PyMOL
Template: 1HJB, chain A
Confidence level:probable
Coverage over the Query: 108-158
View the alignment between query and template
View the model in PyMOL