Citrus Sinensis ID: 019560


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MMYSLRRVMAQIGRSQTTVKRIILYSPAHFTRPFSSRAHQFTKATTKTTTSKDVVWPKPSEIPFQVKVANSVNLIGHVDAPVQFQTSSDGKHWAGTVIVQHAASHSLWIPILFEGDLAHIASSHLKKDDHVHIAGQLTADPPAIEGQANVQVMVHSLNLIEPTSQKRMFFVSKKQEAATVDHSVKISSSKKDGDSALSSWRDLLDNPEQWRDYRSDKLKGLVKPRYPDFKRKDGTLPLWLNSAPDWVLSELEGVVFDKSKPVLDDQTRKSNYVKKSKVDDLWKDLVENPDKWWDNRLDKKSEKGPDFKHKETGKPLWLNYSPAWVTSQLPPVKSTVKSK
ccHHHHHHHHHccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccEEEEcccccEEEEEEEEEcccccccEEEEEECcHHHHHHHHHcccccEEEEEEEEEEccccccccCEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccEEccccccHHHHHHccccccccccccccccccccccccccHHHHHHHHHHccHHHHHccccccccccccccccccccEEccccccHHHHccccccccccccc
********MAQIGRSQTTVKRIILYSPAHF************************VWPKPSEIPFQVKVANSVNLIGHVDAPVQFQTSSDGKHWAGTVIVQHAASHSLWIPILFEGDLAHIASSHLKKDDHVHIAGQLTADPPAIEGQANVQVMVHSLNLIEP***************************************DLLDNPEQWRDYR*DKLKGLVKPRYPDFKRKDGTLPLWLNSAPDWVLSELEGVVFDK******************KVDDLWKDLVENPDKWWDNRLDKKS**GPDFKHKETGKPLWLNYSPAWVTSQLP*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMYSLRRVMAQIGRSQTTVKRIILYSPAHFTRPFSSRAHQFTKATTKTTTSKDVVWPKPSEIPFQVKVANSVNLIGHVDAPVQFQTSSDGKHWAGTVIVQHAASHSLWIPILFEGDLAHIASSHLKKDDHVHIAGQLTADPPAIEGQANVQVMVHSLNLIEPTSQKRMFFVSKKQEAATVDHSVKISSSKKDGDSALSSWRDLLDNPEQWRDYRSDKLKGLVKPRYPDFKRKDGTLPLWLNSAPDWVLSELEGVVFDKSKPVLDDQTRKSNYVKKSKVDDLWKDLVENPDKWWDNRLDKKSEKGPDFKHKETGKPLWLNYSPAWVTSQLPPVKSTVKSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein OSB2, chloroplastic Binds preferentially single-stranded DNA. Does not bind to RNA.probableQ8GXH3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3K81, chain C
Confidence level:confident
Coverage over the Query: 67-162
View the alignment between query and template
View the model in PyMOL