Citrus Sinensis ID: 019565


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MAASSAGNHSTPHNTKPFEFSAVDFPPRISLTADQYNHCSEALSFFKEKLQNKSREISQEFARLQASRIKPSEMARGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQFIATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQAEDGPREFGNIGIVTKWIKTTETALVLRNLEVNYKESEEPPMSVLHIQYPEWPDHGVPRDTLAVREILKRIYNLPPNFGPIVVHCSAGIGRTGAYCTIHNTVQRILVGDMSALDLANTVKVFRSQRIGMVQTMVLSSFLVQSLVSFSYSLFLIMHLSF
ccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEccccccccccccEEcccccccccccccccEEEccccccccHHHHHHHHHHccccEEEEEcccECcccccccccccccccccEEEEEEEEEEEEEEEEcccEEEEEEEEEEcccccccEEEEEEccccccccccccccHHHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHHHHHHHcccccEEEHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccc
*********************AVDFPPRISL**DQYNHCSEALSFFK*K******EISQEFARLQASRI*****ARGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQFIATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQAEDGPREFGNIGIVTKWIKTTETALVLRNLEVNYK***EPPMSVLHIQYPEWPDHGVPRDTLAVREILKRIYNLPPNFGPIVVHCSAGIGRTGAYCTIHNTVQRILVGDMSALDLANTVKVFRSQRIGMVQTMVLSSFLVQSLVSFSYSLFLIM*L**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAASSAGNHSTPHNTKPFEFSAVDFPPRISLTADQYNHCSEALSFFxxxxxxxxxxxxxxxxxxxxxRIKPSEMARGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQFIATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQAEDGPREFGNIGIVTKWIKTTETALVLRNLEVNYKESEEPPMSVLHIQYPEWPDHGVPRDTLAVREILKRIYNLPPNFGPIVVHCSAGIGRTGAYCTIHNTVQRILVGDMSALDLANTVKVFRSQRIGMVQTMVLSSFLVQSLVSFSYSLFLIMHLSF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein-tyrosine-phosphatase PTP1 Protein-tyrosine-phosphatase that dephosphorylates and probably inhibits MPK6 in non-oxidative stress conditions. In association with MKP1, represses salicylic acid (SA) and camalexin biosynthesis, thus modulating defense response. May also repress MPK3. Dephosphorylates and inactivates MPK4 in vitro.probableO82656

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JJD, chain A
Confidence level:very confident
Coverage over the Query: 26-329
View the alignment between query and template
View the model in PyMOL