Citrus Sinensis ID: 019579

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MRPLDSLPPTEALEIENGLKLVPRMKLTLTINPATPSATKPIDEWQLKRALTDFLKTSLSVPITVPEEDLEIRRFRDLKKRKRDDPVAHGNLFIRDFEFLHKTRRKNADEETDLKVLEKQLSDWKKYIVEKMDGIELNLEGVKYKLSVVIPIADDFEKMRKDWEEFYAFGNRGYSRGKQEPDTIVIKGVPSRWFAEPRVSSKPSMLVTHTVFSTFGKIRNLNVAEDDDPGKDADEDGGDIISGLHCKIVVQFEKYRDFYNTLKVLCGRSMQKQGSQLKADYEVTWDKDGFFWDSRNQAEEKSNRMPLKTARQYRSETSRHEVYSSQLAADHTRRKRFKE
cccccccccccccccccccEEccEEEEEEEEEcccccccccccHHHHHHHHHHHHccccccccEEccccccEEEEccccccccccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccEEEEEEccccccccccccHHHHHHccccccccccccccEEEEccccccEEEcccccccccHHHHHHHHHHccccEEEEcccccccccccccccccccccEEEEEEEEEEEHHHHHHHHHHHcccccEEEccEEEEEEEEEEccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cccHHHcccccccccccccccccEEEEEEEEEcccccccccccHHHHHHHHHHHHcccccccccccccccEEEEcccHHHHccccccEEEEEEEEcccHcccccccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccEEEEEEEEccccccHHHHccHHHHHHHcccccccccccccEEEEEccccEEEEccccccccHHHHHHHHHHHHccEEEccccccccHHHHHcccccccEcccEEEEEEEEEcHHHHHHHHHHHHccHHHccccccEEEEEEEccccccccccHHHHHHHcccccHHHHccccccccccccccccccccccccHHccc
mrpldslpptealeienglklvprmkltltinpatpsatkpidEWQLKRALTDFLKtslsvpitvpeedlEIRRFRDLkkrkrddpvahgnlfiRDFEFLHKTRRKNADEETDLKVLEKQLSDWKKYIVEKMDGIELNLEGVKYKLSVVIPIADDFEKMRKDWEEFYAfgnrgysrgkqepdtivikgvpsrwfaeprvsskpsmlvTHTVFSTFGKirnlnvaedddpgkdadedggdiisGLHCKIVVQFEKYRDFYNTLKVLCGRsmqkqgsqlkadyevtwdkdgffwdsrnqaeeksnrmplktaRQYRsetsrhevyssqlaaDHTRRKRFKE
mrpldslpptealeienglklvpRMKLTLtinpatpsatkpidewQLKRALTDFLktslsvpitvpeedleirrfrdlkkrkrddpvahgnlfirdfeflhktrrknadeetdlkvLEKQLSDWKKYIVEKMDGIELNLEGVKYKLSVVIPIADDFEKMRKDWEEFYAFgnrgysrgkqepdtiVIKGVPSRWFaeprvsskpsmlVTHTVFSTFGKIRNLNVAEDDDPGKDADEDGGDIISGLHCKIVVQFEKYRDFYNTLKVLCGRSMQKQGSQLKADYEVTWDKDGFFWDSrnqaeeksnrmplktarqyrsetsrhevyssqlaadhtrrkrfke
MRPLDSLPPTEALEIENGLKLVPRMKLTLTINPATPSATKPIDEWQLKRALTDFLKTSLSVPITVPEEDLEIrrfrdlkkrkrddPVAHGNLFIRDFEFLHKTRRKNADEETDLKVLEKQLSDWKKYIVEKMDGIELNLEGVKYKLSVVIPIADDFEKMRKDWEEFYAFGNRGYSRGKQEPDTIVIKGVPSRWFAEPRVSSKPSMLVTHTVFSTFGKIRNLNVaedddpgkdadedggdIISGLHCKIVVQFEKYRDFYNTLKVLCGRSMQKQGSQLKADYEVTWDKDGFFWDSRNQAEEKSNRMPLKTARQYRSETSRHEVYSSQLAADHTRRKRFKE
*****************GLKLVPRMKLTLTINPAT**ATKPIDEWQLKRALTDFLKTSLSVPITVPEEDLEIRRFRDL*******PVAHGNLFIRDFEFLHKTR********DLKVLEKQLSDWKKYIVEKMDGIELNLEGVKYKLSVVIPIADDFEKMRKDWEEFYAFGNRGYSRGKQEPDTIVIKGVPSRWFAEPRVSSKPSMLVTHTVFSTFGKIRNLNV**************GDIISGLHCKIVVQFEKYRDFYNTLKVLCGRSMQKQGSQLKADYEVTWDKDGFFWD**********************************************
******LPPTEALEIENGLKLVPRMKLTLTINPATPSATKPIDEWQLKRALTDFLKTSLSVPITVPEEDLEIRRFRDLKKRKRDDPVAHGNLFIRDFEFLHKTRR*NADEETDLKVLEKQLSDWKKYIVEKMDGIELNLEGVKYKLSVVIPIADDFEKMRKDWEEF****************TIVIKGVPSRWFAEP*****P*MLVTHTVFSTFGKIRNLNVAEDD***************GLHCKIVVQFEKYRDFYNTLKVLCGRSMQKQGSQLKADYEVTWDKDGF*************************************************
MRPLDSLPPTEALEIENGLKLVPRMKLTLTINPATPSATKPIDEWQLKRALTDFLKTSLSVPITVPEEDLEIRRFRDLKKRKRDDPVAHGNLFIRDFEFLHKTRRKNADEETDLKVLEKQLSDWKKYIVEKMDGIELNLEGVKYKLSVVIPIADDFEKMRKDWEEFYAFGNRGYSRGKQEPDTIVIKGVPSRWFAEPRVSSKPSMLVTHTVFSTFGKIRNLNVAEDDDPGKDADEDGGDIISGLHCKIVVQFEKYRDFYNTLKVLCGRSMQKQGSQLKADYEVTWDKDGFFWDSRNQA*****************************************
*****SLPPTEALEIENGLKLVPRMKLTLTINPATPSATKPIDEWQLKRALTDFLKTSLSVPITVPEEDLEIRRFRDLKKRKRDDPVAHGNLFIRDFEFLHK*******EETDLKVLEKQLSDWKKYIVEKMDGIELNLEGVKYKLSVVIPIADDFEKMRKDWEEFYAFGNRG****KQEPDTIVIKGVPSRWFAEPRVSSKPSMLVTHTVFSTFGKIRNLNVAEDDDPGKDADEDGGDIISGLHCKIVVQFEKYRDFYNTLKVLCGRSMQKQGSQLKADYEVTWDKDGFFWDS*********************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRPLDSLPPTEALEIENGLKLVPRMKLTLTINPATPSATKPIDEWQLKRALTDFLKTSLSVPITVPEEDLEIRRFRDLKKRKRDDPVAHGNLFIRDFEFxxxxxxxxxxxxxxxxxxxxxLSDWKKYIVEKMDGIELNLEGVKYKLSVVIPIADDFEKMRKDWEEFYAFGNRGYSRGKQEPDTIVIKGVPSRWFAEPRVSSKPSMLVTHTVFSTFGKIRNLNVAEDDDPGKDADEDGGDIISGLHCKIVVQFEKYRDFYNTLKVLCGRSMQKQGSQLKADYEVTWDKDGFFWDSRNQAEEKSNRMPLKTARQYRSETSRHEVYSSQLAADHTRRKRFKE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query339 2.2.26 [Sep-21-2011]
A2A3V1 959 A-kinase anchor protein 1 yes no 0.415 0.147 0.3 8e-08
Q02040 695 A-kinase anchor protein 1 yes no 0.495 0.241 0.275 3e-06
>sp|A2A3V1|AK17B_MOUSE A-kinase anchor protein 17B OS=Mus musculus GN=Akap17b PE=1 SV=2 Back     alignment and function desciption
 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 77/160 (48%), Gaps = 19/160 (11%)

Query: 131 KMDGIELNLEGVKYKLSVVIPIADDFEKMRKDWEEFYAFGNRGYSRGKQE------PDTI 184
           K+ G  + L G+K  L VV   A      + +WE F          G +E      PD+I
Sbjct: 94  KLHGKIIKLNGLKTDLKVVATDA------QGEWEHFPKEKEASVIEGAEEQDHDKGPDSI 147

Query: 185 VIKGVPSRWFAEPRVSS--KPSMLVTHTVFSTFGKIRNLNVAEDDDPGKDADEDG--GDI 240
             +G+P +WFA P+ SS  KP   +   VF +FGKI+N+++    DP ++    G  G +
Sbjct: 148 YFEGLPCKWFA-PKGSSGEKPCEEILRVVFESFGKIKNVDIPM-LDPYREVMTGGSFGGL 205

Query: 241 ISGLHC-KIVVQFEKYRDFYNTLKVLCGRSMQKQGSQLKA 279
             GL   +  +Q+++  DF   ++ L G  +  +G   KA
Sbjct: 206 NFGLQTFEAFIQYQESTDFIKAMESLRGMKLMLKGDDGKA 245
Splice factor regulating alternative splice site selection for certain mRNA precursors.
Mus musculus (taxid: 10090)
>sp|Q02040|AK17A_HUMAN A-kinase anchor protein 17A OS=Homo sapiens GN=AKAP17A PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query339
359491959339 PREDICTED: A-kinase anchor protein 17A-l 0.979 0.979 0.695 1e-133
147785331384 hypothetical protein VITISV_013942 [Viti 0.979 0.864 0.690 1e-132
224067202341 predicted protein [Populus trichocarpa] 0.982 0.976 0.710 1e-130
255538052369 conserved hypothetical protein [Ricinus 0.958 0.880 0.7 1e-130
449450287341 PREDICTED: A-kinase anchor protein 17A-l 0.997 0.991 0.644 1e-124
18406392324 protein ZCW7 [Arabidopsis thaliana] gi|6 0.946 0.990 0.643 1e-119
343455577324 At1g59600 [Arabidopsis thaliana] 0.946 0.990 0.640 1e-119
297837585324 hypothetical protein ARALYDRAFT_893620 [ 0.946 0.990 0.628 1e-117
8778765383 T30E16.16 [Arabidopsis thaliana] 0.952 0.843 0.584 1e-116
356552264324 PREDICTED: uncharacterized protein LOC10 0.884 0.925 0.604 1e-107
>gi|359491959|ref|XP_002285336.2| PREDICTED: A-kinase anchor protein 17A-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  481 bits (1239), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 238/342 (69%), Positives = 275/342 (80%), Gaps = 10/342 (2%)

Query: 2   RPLDSLPPTEALEIENGLKLVPRMKLTLTINPA-TPSATKPIDEWQLKRALTDFLKTSLS 60
           + LDSL PTE LEIENGL LVPR+ L LTI P+ T S TKPIDEWQLKRAL DFLKTS  
Sbjct: 4   KSLDSLRPTETLEIENGLTLVPRVMLNLTIFPSETASVTKPIDEWQLKRALIDFLKTSFH 63

Query: 61  VPITVPEEDLEIRRFRDLKKRKRDDPVAHGNLFIRDFEFLHKTRRKNADEETDLKVLEKQ 120
           VPITVPEEDL I+RF+DLKKRKR DPVA G +FIRD  FL      N   E DL+VL+K+
Sbjct: 64  VPITVPEEDLHIKRFKDLKKRKRVDPVAGGTIFIRDLGFL------NNKNEDDLEVLDKK 117

Query: 121 LSDWKKYIVEKMDGIELNLEGVKYKLSVVIPIADDFEKMRKDWEEFYAFGNRGYSRG--- 177
             DWK  +VEKMDGIELNLEGVK++L V IP  DDF+ M+KDWE+FYAFGNRGYSRG   
Sbjct: 118 FLDWKSSLVEKMDGIELNLEGVKFRLGVAIPATDDFQGMKKDWEDFYAFGNRGYSRGGSG 177

Query: 178 KQEPDTIVIKGVPSRWFAEPRVSSKPSMLVTHTVFSTFGKIRNLNVAEDDDPGKDADEDG 237
           +Q+PDTIV++G PSRWFAEPRVSSKPSMLVTHT+FSTFGKIRNLNVAED+D G   DE+ 
Sbjct: 178 RQQPDTIVLRGAPSRWFAEPRVSSKPSMLVTHTIFSTFGKIRNLNVAEDNDLGDKEDEND 237

Query: 238 GDIISGLHCKIVVQFEKYRDFYNTLKVLCGRSMQKQGSQLKADYEVTWDKDGFFWDSRNQ 297
           GDI+SGLHCKIVVQFE+YRDFYN LKVLCGRS+QKQGS+LKADYEV+WDKDGFF ++R+ 
Sbjct: 238 GDIVSGLHCKIVVQFERYRDFYNALKVLCGRSLQKQGSRLKADYEVSWDKDGFFRNTRSH 297

Query: 298 AEEKSNRMPLKTARQYRSETSRHEVYSSQLAADHTRRKRFKE 339
           A+E+S+RMP   A  Y+S   R + Y      D++R KRFKE
Sbjct: 298 AQERSSRMPEMGADSYKSGAPRRQPYFPHSGYDNSRPKRFKE 339

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147785331|emb|CAN72851.1| hypothetical protein VITISV_013942 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224067202|ref|XP_002302406.1| predicted protein [Populus trichocarpa] gi|222844132|gb|EEE81679.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255538052|ref|XP_002510091.1| conserved hypothetical protein [Ricinus communis] gi|223550792|gb|EEF52278.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449450287|ref|XP_004142895.1| PREDICTED: A-kinase anchor protein 17A-like [Cucumis sativus] gi|449482718|ref|XP_004156383.1| PREDICTED: A-kinase anchor protein 17A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18406392|ref|NP_564748.1| protein ZCW7 [Arabidopsis thaliana] gi|6520227|dbj|BAA87955.1| ZCW7 [Arabidopsis thaliana] gi|332195472|gb|AEE33593.1| protein ZCW7 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|343455577|gb|AEM36362.1| At1g59600 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297837585|ref|XP_002886674.1| hypothetical protein ARALYDRAFT_893620 [Arabidopsis lyrata subsp. lyrata] gi|297332515|gb|EFH62933.1| hypothetical protein ARALYDRAFT_893620 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|8778765|gb|AAF79773.1|AC009317_32 T30E16.16 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356552264|ref|XP_003544488.1| PREDICTED: uncharacterized protein LOC100796960 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query339
TAIR|locus:2202837324 ZCW7 "AT1G59600" [Arabidopsis 0.946 0.990 0.576 1.4e-96
ZFIN|ZDB-GENE-040426-1460 531 akap17a "A kinase (PRKA) ancho 0.625 0.399 0.255 5.1e-10
UNIPROTKB|Q02040 695 AKAP17A "A-kinase anchor prote 0.607 0.296 0.266 3.8e-09
UNIPROTKB|F1PRN0357 F1PRN0 "Uncharacterized protei 0.604 0.574 0.254 4.2e-09
UNIPROTKB|F1NFG4 655 AKAP17A "Uncharacterized prote 0.598 0.309 0.261 4.6e-09
UNIPROTKB|J9JHP7 699 LOC100855889 "Uncharacterized 0.607 0.294 0.266 5e-09
RGD|1566363 942 Akap17b "A kinase (PRKA) ancho 0.604 0.217 0.262 3.6e-08
MGI|MGI:2443758 959 Akap17b "A kinase (PRKA) ancho 0.604 0.213 0.262 3.7e-08
UNIPROTKB|F1RU91 435 AKAP17B "Uncharacterized prote 0.601 0.468 0.261 6.9e-08
UNIPROTKB|K7GKA8 925 AKAP17B "Uncharacterized prote 0.601 0.220 0.261 2.2e-07
TAIR|locus:2202837 ZCW7 "AT1G59600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 960 (343.0 bits), Expect = 1.4e-96, P = 1.4e-96
 Identities = 197/342 (57%), Positives = 240/342 (70%)

Query:     1 MRPLDSLPPTEALEIE-NGLKLVPRMKLTLTINPATPSATKPIDEWQLKRALTDFLKTSL 59
             MR L+ L P E L+IE NGL LV R+KL LTI+P  PS +K IDEWQLKR+L D+LK S+
Sbjct:     1 MRSLEELSPIETLDIEENGLALVSRVKLNLTIHPVVPSVSKSIDEWQLKRSLIDYLKNSV 60

Query:    60 SVPITVPEEDLEIXXXXXXXXXXXXXPVAHGNLFIRDFEFLH-KTRRKNADEETDLKVLE 118
                +TVPEED+ +             PVAHG+LFIRD  FL  K ++K  D E D+K LE
Sbjct:    61 VTSVTVPEEDIVVRRHKDLKKRKREEPVAHGSLFIRDLGFLDGKKKKKENDGERDVKELE 120

Query:   119 KQLSDWKKYIVEKMDGIELNLEGVKYKLSVVIPIADDFEKMRKDWEEFYAFGNRGYSR-G 177
             K+  DW+K +VEKM+GIELNLEGVKYKLSVV+PI+DDFEK++KDWEEFYAFG   +SR G
Sbjct:   121 KKFLDWRKSLVEKMNGIELNLEGVKYKLSVVLPISDDFEKLKKDWEEFYAFG---HSREG 177

Query:   178 KQEPDTIVIKGVPSRWFAEPRVSSKPSMLVTHTVFSTFGKIRNLNVXXXXXXXXXXXXXX 237
             ++E DTI+++GVPSRWFAEPRVSSKPSMLVTHT+FS+FGKIRNLNV              
Sbjct:   178 RREADTIILRGVPSRWFAEPRVSSKPSMLVTHTIFSSFGKIRNLNVAEDDDLGKDADEDS 237

Query:   238 XXIISGLHCKIVVQFEKYRDFYNTLKVLCGRSMQKQGSQLKADYEVTWDKDGFFWDSRNQ 297
               +ISGLHCKIVVQFEKY DF N +K  CGRSM+K+G++LKADYE+TWDK GFF +SR  
Sbjct:   238 GDLISGLHCKIVVQFEKYNDFVNAMKAFCGRSMEKEGTRLKADYELTWDKIGFFRNSRKP 297

Query:   298 AEEKSNRMPLKTARQYRSETSRHEVYSSQLAADHTRRKRFKE 339
              + +           YR+E       S     D  RRKRF+E
Sbjct:   298 LDNRDGG--------YRNE-------SFGCNQDDLRRKRFRE 324
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
ZFIN|ZDB-GENE-040426-1460 akap17a "A kinase (PRKA) anchor protein 17A" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q02040 AKAP17A "A-kinase anchor protein 17A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PRN0 F1PRN0 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NFG4 AKAP17A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9JHP7 LOC100855889 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1566363 Akap17b "A kinase (PRKA) anchor protein 17B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2443758 Akap17b "A kinase (PRKA) anchor protein 17B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1RU91 AKAP17B "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|K7GKA8 AKAP17B "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00014962001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (342 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query339
cd12264121 cd12264, RRM_AKAP17A, RNA recognition motif found 7e-48
>gnl|CDD|240710 cd12264, RRM_AKAP17A, RNA recognition motif found in A-kinase anchor protein 17A (AKAP-17A) and similar proteins Back     alignment and domain information 
 Score =  157 bits (398), Expect = 7e-48
 Identities = 51/118 (43%), Positives = 71/118 (60%), Gaps = 5/118 (4%)

Query: 179 QEPDTIVIKGVPSRWFAEPRVSSKPSMLVTHTVFSTFGKIRNLNVAEDDDPGKDADEDGG 238
           + PDTI ++G+P RWFAEPRVS KPS LV  TVFS FG+IRN+++   D   K+ D+ G 
Sbjct: 2   ERPDTIHLEGLPCRWFAEPRVSDKPSELVLRTVFSKFGEIRNVDIPMLDPYRKEMDDRGS 61

Query: 239 DI---ISGLHCKIVVQFEKYRDFYNTLKVLCGRSMQKQG--SQLKADYEVTWDKDGFF 291
           D     S LH ++ VQ+E+Y  F   +  L G  +Q +G    L A+ +V +DK    
Sbjct: 62  DTFSFGSHLHFEVYVQYEEYDGFVKAMDALRGMKLQYKGDGKALAANIKVDFDKTKHL 119

This subfamily corresponds to the RRM domain of AKAP-17A, also termed 721P, or splicing factor, arginine/serine-rich 17A (SFRS17A). It was originally reported as the pseudoautosomal or X inactivation escape gene 7 (XE7) and as B-lymphocyte antigen precursor. It has been suggested that AKAP-17A is an alternative splicing factor and an SR-related splicing protein that interacts with the classical SR protein ASF/SF2 and the SR-related factor ZNF265. Additional studies have indicated that AKAP-17A is a dual-specific protein kinase A anchoring protein (AKAP) that can bind both type I and type II protein kinase A (PKA) with high affinity and co-localizes with the catalytic subunit of PKA in nuclear speckles as well as the splicing factor SC35 in splicing factor compartments. It is involved in regulation of pre-mRNA splicing possibly by docking a pool of PKA in splicing factor compartments. AKAP-17A contains an RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain). . Length = 121

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 339
KOG2891 445 consensus Surface glycoprotein [General function p 100.0
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 98.95
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 98.7
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 98.62
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 98.54
smart0036272 RRM_2 RNA recognition motif. 98.51
smart0036071 RRM RNA recognition motif. 98.42
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.42
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 98.4
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 98.38
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 98.3
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 98.22
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 98.17
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 98.13
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.13
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 98.13
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 98.12
PLN03120 260 nucleic acid binding protein; Provisional 98.11
smart0036170 RRM_1 RNA recognition motif. 98.06
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 98.04
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 98.04
KOG4207 256 consensus Predicted splicing factor, SR protein su 98.0
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 97.99
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 97.99
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 97.99
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 97.93
PLN03213 759 repressor of silencing 3; Provisional 97.92
KOG0111 298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 97.92
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 97.87
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 97.82
KOG0126219 consensus Predicted RNA-binding protein (RRM super 97.67
COG0724306 RNA-binding proteins (RRM domain) [General functio 97.59
KOG0125 376 consensus Ataxin 2-binding protein (RRM superfamil 97.52
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 97.46
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 97.45
PLN03121 243 nucleic acid binding protein; Provisional 97.43
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 97.41
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 97.29
KOG0147 549 consensus Transcriptional coactivator CAPER (RRM s 97.25
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 96.72
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 96.67
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 96.52
KOG0114124 consensus Predicted RNA-binding protein (RRM super 96.45
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 96.41
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 96.35
KOG0149 247 consensus Predicted RNA-binding protein SEB4 (RRM 95.93
KOG0122270 consensus Translation initiation factor 3, subunit 95.55
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 95.34
KOG0105 241 consensus Alternative splicing factor ASF/SF2 (RRM 95.3
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 95.23
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 95.11
KOG0121153 consensus Nuclear cap-binding protein complex, sub 95.02
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 94.9
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 94.55
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 94.52
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 94.46
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 94.39
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 94.3
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 94.21
KOG4660 549 consensus Protein Mei2, essential for commitment t 94.08
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 93.83
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 93.76
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 93.63
KOG2314 698 consensus Translation initiation factor 3, subunit 92.8
KOG1190 492 consensus Polypyrimidine tract-binding protein [RN 91.82
KOG0123369 consensus Polyadenylate-binding protein (RRM super 91.35
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 91.13
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 91.05
KOG0148 321 consensus Apoptosis-promoting RNA-binding protein 91.03
KOG0145 360 consensus RNA-binding protein ELAV/HU (RRM superfa 90.95
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 90.11
KOG0153377 consensus Predicted RNA-binding protein (RRM super 89.84
KOG0533243 consensus RRM motif-containing protein [RNA proces 89.75
COG5175 480 MOT2 Transcriptional repressor [Transcription] 89.7
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 88.4
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 88.12
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 86.28
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 85.71
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 85.6
KOG0146 371 consensus RNA-binding protein ETR-3 (RRM superfami 83.98
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 83.17
KOG0147 549 consensus Transcriptional coactivator CAPER (RRM s 82.9
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 80.57
>KOG2891 consensus Surface glycoprotein [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-83  Score=611.39  Aligned_cols=255  Identities=25%  Similarity=0.450  Sum_probs=234.1

Q ss_pred             CCCC-CCCceeecCCCeeeeceeeEEEEEe-cCCCCCCCCCChHHHHHHHHHhhccCCccceeecCCcchhhhhhhhhcc
Q 019579            4 LDSL-PPTEALEIENGLKLVPRMKLTLTIN-PATPSATKPIDEWQLKRALTDFLKTSLSVPITVPEEDLEIRRFRDLKKR   81 (339)
Q Consensus         4 ~~~~-~~~e~l~l~~gLyLkP~akl~Isv~-P~~~~~gksIsnWevme~L~~~~~~~~~~sl~v~~stl~~~Rf~dL~~r   81 (339)
                      +.|+ |+++.+|..+||||||+++++|||. |+++.||+|||||+|||+|+.+|.|+||.|++|.+|++++|+|      
T Consensus         9 ld~lgseaedf~kaq~lylkpia~ikisv~lpql~ipgksisnwdlmerlk~aid~~q~dsckiresnid~iif------   82 (445)
T KOG2891|consen    9 LDDLGSEAEDFCKAQGLYLKPIAKIKISVALPQLKIPGKSISNWDLMERLKGAIDNHQFDSCKIRESNIDFIIF------   82 (445)
T ss_pred             HhhhhhHHHhhhhhcceeeccceeEEEEEecccccCCCcccchHHHHHHHHhhcccccccceeecccccceEEe------
Confidence            4566 8999999999999999999999999 9999999999999999999999999999999999999999997      


Q ss_pred             cCCCCCcccceeeeehhhhhhcccCCCchhhHHHHHHHhhhhHHHHHHhhccCeeEEecCccceeEEEcccC-CCchhhh
Q 019579           82 KRDDPVAHGNLFIRDFEFLHKTRRKNADEETDLKVLEKQLSDWKKYIVEKMDGIELNLEGVKYKLSVVIPIA-DDFEKMR  160 (339)
Q Consensus        82 kR~~pva~g~L~i~~~~~lr~~~~~~~e~e~e~k~l~~~~~~~~~~l~~kLdG~~lkLsGf~~~LkV~a~es-~dFp~~r  160 (339)
                                                 |+|.+++.++++|       +++|||++||||||.++|+|+++|+ .||| +|
T Consensus        83 ---------------------------eael~n~gimkk~-------l~~ldgfsiklsgfad~lkvka~eakidfp-sr  127 (445)
T KOG2891|consen   83 ---------------------------EAELENKGIMKKF-------LACLDGFSIKLSGFADILKVKAAEAKIDFP-SR  127 (445)
T ss_pred             ---------------------------eHhhhhhhHHHHH-------HHHhcCCeeeecccchHHhhhHHhhcCCCC-cc
Confidence                                       9999999997655       7999999999999999999999996 9999 99


Q ss_pred             hcHHHHhhccCC--CCCCCCCCCCeEEEcCCccccccCCC--CCCCCcHHHHHHHhhccCceeeeeecCCCCCCCCCCCC
Q 019579          161 KDWEEFYAFGNR--GYSRGKQEPDTIVIKGVPSRWFAEPR--VSSKPSMLVTHTVFSTFGKIRNLNVAEDDDPGKDADED  236 (339)
Q Consensus       161 hdWesff~d~~~--~~~~~geRPDTI~l~gLP~rWFa~~~--~s~kPSE~vl~~vFe~FGkIRnvDIP~~Dpyr~~~~~~  236 (339)
                      ||||+||+++++  +|.+ |||||||||.||||+|||-+.  +..-|||.+|+.+|++||.|||||||||||||+.|++.
T Consensus       128 hdwdd~fm~~kdmdemkp-gerpdti~la~ip~kwf~lkedg~~dlpse~rlr~a~eafg~ir~vdipicdplr~~mn~k  206 (445)
T KOG2891|consen  128 HDWDDFFMDAKDMDEMKP-GERPDTIHLAGIPCKWFALKEDGSEDLPSEDRLRKAFEAFGEIRNVDIPICDPLREEMNGK  206 (445)
T ss_pred             cchHHHHhhhhhhhccCC-CCCCCceeecCCcceeeeecccccccCChHHHHHHHHHHhccceecCCcccchhHHHhcCc
Confidence            999999999995  4444 999999999999999999543  35679999999999999999999999999999998644


Q ss_pred             -CC------CcccceeEEEEEEeccchHHHHHHHHhcCccceec--CceeEEEEEEeecccCCCcccccchHH
Q 019579          237 -GG------DIISGLHCKIVVQFEKYRDFYNTLKVLCGRSMQKQ--GSQLKADYEVTWDKDGFFWDSRNQAEE  300 (339)
Q Consensus       237 -~g------~~~~gL~FeayVQy~eY~~F~kAM~aLrGmKL~~k--Gk~l~a~ikV~fD~tkhlSe~~i~~~e  300 (339)
                       +|      +++++|+|||||||.||.||..||++||||||+++  |..|.||+|||||++.|||+.||-.+-
T Consensus       207 isgiq~~gfg~g~dlffeayvqfmeykgfa~amdalr~~k~akk~d~~ffqanvkvdfdrsrhlsevqiakra  279 (445)
T KOG2891|consen  207 ISGIQFHGFGFGGDLFFEAYVQFMEYKGFAQAMDALRGMKLAKKGDDGFFQANVKVDFDRSRHLSEVQIAKRA  279 (445)
T ss_pred             cccceeeccccCcchhHHHHHHHHHHHhHHHHHHHHhcchHHhhcCCcccccccccccchhhhhhHHHHHHHH
Confidence             33      35566899999999999999999999999999997  479999999999999999999995443

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query339
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.08
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.05
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.04
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.03
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.03
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.03
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.02
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.01
2div_A99 TRNA selenocysteine associated protein; structural 99.01
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.01
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.0
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 98.99
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 98.99
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 98.98
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 98.98
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 98.98
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 98.98
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 98.97
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 98.97
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 98.97
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 98.96
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 98.95
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 98.95
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 98.95
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 98.94
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 98.94
2cph_A107 RNA binding motif protein 19; RNA recognition moti 98.93
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 98.93
2la6_A99 RNA-binding protein FUS; structural genomics, nort 98.93
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 98.92
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 98.92
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 98.92
2krb_A81 Eukaryotic translation initiation factor 3 subunit 98.91
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 98.91
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 98.91
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 98.91
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 98.9
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 98.9
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 98.9
3p5t_L90 Cleavage and polyadenylation specificity factor S; 98.9
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 98.9
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 98.9
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 98.9
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 98.89
1x4e_A85 RNA binding motif, single-stranded interacting pro 98.89
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 98.89
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 98.89
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 98.88
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 98.88
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 98.87
2kt5_A124 RNA and export factor-binding protein 2; chaperone 98.87
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 98.87
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 98.87
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 98.86
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 98.86
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 98.86
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.85
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 98.85
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 98.85
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 98.85
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 98.85
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 98.84
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 98.84
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 98.84
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 98.83
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 98.83
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 98.83
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 98.83
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.83
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 98.82
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 98.82
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 98.81
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 98.81
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.81
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 98.81
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 98.81
2dis_A109 Unnamed protein product; structural genomics, RRM 98.81
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 98.8
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 98.8
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 98.8
2cqd_A116 RNA-binding region containing protein 1; RNA recog 98.8
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 98.8
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 98.8
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 98.79
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 98.79
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 98.79
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 98.78
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 98.78
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 98.78
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 98.77
2cpj_A99 Non-POU domain-containing octamer-binding protein; 98.77
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 98.76
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 98.76
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.75
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 98.75
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 98.75
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 98.75
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 98.74
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 98.74
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 98.74
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 98.73
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 98.73
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 98.73
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 98.73
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 98.73
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 98.73
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 98.72
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 98.72
1x5o_A114 RNA binding motif, single-stranded interacting pro 98.72
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 98.72
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 98.72
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.72
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 98.71
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 98.71
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 98.7
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 98.69
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 98.69
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 98.69
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.69
3n9u_C156 Cleavage and polyadenylation specificity factor S; 98.69
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 98.68
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 98.67
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 98.67
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 98.67
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.67
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 98.67
2i2y_A150 Fusion protein consists of immunoglobin G- binding 98.66
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 98.66
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 98.65
2f3j_A177 RNA and export factor binding protein 2; RRM domai 98.65
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 98.64
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 98.64
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.64
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 98.63
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 98.63
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 98.62
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 98.62
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 98.62
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 98.62
3q2s_C229 Cleavage and polyadenylation specificity factor S; 98.61
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 98.6
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 98.59
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 98.58
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 98.58
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 98.58
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 98.57
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 98.57
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 98.57
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 98.56
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 98.55
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 98.54
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 98.54
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 98.54
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 97.94
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 98.53
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 98.53
2dnl_A114 Cytoplasmic polyadenylation element binding protei 98.52
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 98.51
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 98.51
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 98.5
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 98.5
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 98.5
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 98.5
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 98.5
1x5p_A97 Negative elongation factor E; structure genomics, 98.48
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 98.48
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 98.47
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 98.46
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 98.46
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.45
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 98.44
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 98.44
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 98.42
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 98.4
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 98.4
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 98.39
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 98.39
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 98.39
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.37
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 98.36
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 98.36
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 98.34
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 98.33
2dit_A112 HIV TAT specific factor 1 variant; structural geno 98.33
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 98.33
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 98.32
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 98.32
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 98.3
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 98.3
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 98.3
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 98.29
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 98.23
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 98.2
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 98.19
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 98.19
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 98.17
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 98.13
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.06
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 98.01
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 97.95
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 97.95
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 97.94
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 97.86
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 97.82
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 97.82
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 97.75
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 97.65
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 97.48
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
Probab=99.08  E-value=2.9e-10  Score=89.98  Aligned_cols=76  Identities=18%  Similarity=0.381  Sum_probs=65.6

Q ss_pred             CeEEEcCCccccccCCCCCCCCcHHHHHHHhhccCceeeeeecCCCCCCCCCCCCCCCcccceeEEEEEEeccchHHHHH
Q 019579          182 DTIVIKGVPSRWFAEPRVSSKPSMLVTHTVFSTFGKIRNLNVAEDDDPGKDADEDGGDIISGLHCKIVVQFEKYRDFYNT  261 (339)
Q Consensus       182 DTI~l~gLP~rWFa~~~~s~kPSE~vl~~vFe~FGkIRnvDIP~~Dpyr~~~~~~~g~~~~gL~FeayVQy~eY~~F~kA  261 (339)
                      -+|||.|||..+          +|+.|+.+|++||+|..|.|+.+...++.         .|+   |||+|....+..+|
T Consensus        20 t~lfV~nLp~~~----------te~~L~~~F~~~G~I~~v~i~~d~~tg~~---------kG~---afV~f~~~~~A~~A   77 (99)
T 4fxv_A           20 TNLIVNYLPQNM----------TQDELRSLFSSIGEVESAKLIRDKVAGHS---------LGY---GFVNYVTAKDAERA   77 (99)
T ss_dssp             SEEEEESCCTTC----------CHHHHHHHHHTTSCEEEEEEEECSSSCCE---------EEE---EEEEESSHHHHHHH
T ss_pred             CEEEEeCCCCCC----------CHHHHHHHHHhcCCEEEeEeeecCCCCcc---------ccc---EEEEECCHHHHHHH
Confidence            379999999988          89999999999999999999987544442         366   99999999999999


Q ss_pred             HHHhcCccceecCceeEEEE
Q 019579          262 LKVLCGRSMQKQGSQLKADY  281 (339)
Q Consensus       262 M~aLrGmKL~~kGk~l~a~i  281 (339)
                      +++|.|..|  .|+.+.+++
T Consensus        78 i~~lng~~~--~gr~l~V~~   95 (99)
T 4fxv_A           78 INTLNGLRL--QSKTIKVSY   95 (99)
T ss_dssp             HHHHTTCEE--TTEECEEEE
T ss_pred             HHHhCCCEE--CCEEEEEEE
Confidence            999999988  888766543
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query339
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.15
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.13
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.13
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.13
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.13
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.11
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.1
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.09
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.07
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.06
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.05
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.03
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.03
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.02
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.01
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.0
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.0
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.0
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 98.97
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.97
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 98.96
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 98.95
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 98.93
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.93
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.93
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.91
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.91
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 98.91
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.91
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 98.91
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 98.91
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 98.9
d2cpja186 Non-POU domain-containing octamer-binding protein, 98.89
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 98.89
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.88
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 98.87
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 98.86
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 98.85
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 98.85
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 98.84
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.83
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 98.83
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 98.82
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 98.81
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 98.79
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 98.79
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 98.79
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.79
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 98.78
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 98.76
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 98.76
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 98.76
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 98.76
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.75
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.74
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.73
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.72
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 98.7
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 98.7
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.68
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.67
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 98.63
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 98.62
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 98.61
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 98.59
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 98.58
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 98.57
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 98.56
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 98.54
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.52
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 98.5
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 98.5
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.48
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 98.48
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.47
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.39
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 98.39
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 98.38
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 98.26
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 98.24
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.19
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 98.16
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.06
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.06
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 98.03
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 97.81
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 97.59
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: CBP20, 20KDa nuclear cap-binding protein
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.15  E-value=6e-11  Score=91.61  Aligned_cols=82  Identities=16%  Similarity=0.274  Sum_probs=69.0

Q ss_pred             CCCCCeEEEcCCccccccCCCCCCCCcHHHHHHHhhccCceeeeeecCCCCCCCCCCCCCCCcccceeEEEEEEeccchH
Q 019579          178 KQEPDTIVIKGVPSRWFAEPRVSSKPSMLVTHTVFSTFGKIRNLNVAEDDDPGKDADEDGGDIISGLHCKIVVQFEKYRD  257 (339)
Q Consensus       178 geRPDTI~l~gLP~rWFa~~~~s~kPSE~vl~~vFe~FGkIRnvDIP~~Dpyr~~~~~~~g~~~~gL~FeayVQy~eY~~  257 (339)
                      .+...||||.|||..|          +++.|+.+|++||+|.+|.|+.+...+.         ..|+   |||+|....+
T Consensus         4 ~~~s~tlfV~nlp~~~----------te~~l~~~F~~~G~i~~v~i~~~~~~~~---------~kg~---afV~f~~~~~   61 (93)
T d1h2vz_           4 LKKSCTLYVGNLSFYT----------TEEQIYELFSKSGDIKKIIMGLDKMKKT---------ACGF---CFVEYYSRAD   61 (93)
T ss_dssp             TTTCCEEEEESCCTTC----------CHHHHHHHHGGGSCEEEEEEEECTTTCC---------EEEE---EEEEESSHHH
T ss_pred             cCCCCEEEEeCCCCCC----------CHHHHHHHHHHHCCcceecccccccccc---------ccce---EEEEECCHHH
Confidence            3567899999999988          8999999999999999999998644433         2366   9999999999


Q ss_pred             HHHHHHHhcCccceecCceeEEEEEEeecc
Q 019579          258 FYNTLKVLCGRSMQKQGSQLKADYEVTWDK  287 (339)
Q Consensus       258 F~kAM~aLrGmKL~~kGk~l~a~ikV~fD~  287 (339)
                      ..+||+.|.|..+  .|+.+.    |+|+.
T Consensus        62 A~~Ai~~l~g~~~--~gr~i~----V~~a~   85 (93)
T d1h2vz_          62 AENAMRYINGTRL--DDRIIR----TDWDA   85 (93)
T ss_dssp             HHHHHHHTTTSEE--TTEECE----EEEES
T ss_pred             HHHHHHHhCCCEE--CCEEEE----EEEcC
Confidence            9999999999998  787655    55554
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure