Citrus Sinensis ID: 019639

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MIFLFSKTFFAKTSFILSLFPFKHSRQMARSAIDEVSETGSFTRTASTFRRFISRDPNSQFPAESGRYHLYISYACPWASRCLAYLKIKGLEKAISFTSVKPIWEQTKETDEHRGWVFPATNTEEPGAEPDPLNGAKTIRDLYELASTNYSGKFTVPVLWDKKLKTIVNNESAEIIRMFNTEFNDIAENASLDLHPSDQRDQIDGTNEWIYNGINNGVYRCGFATKQGPYDEILGKQRYICGNRLTEADIRLFVTLIRFDEVYAVHFKCNKKLLREYPNLFNYTKDIYQIPSMSSTVNMQHIKRHYYGSHPSINPYGIIPLGPDIDYSSPHDREKFSA
ccccccccccccccEEccccccHHHHHHHccccccccccccEEccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHcccccccccEEEccccccccccccccccEEccccccccccccccccccccHHHHHHHcccccccccEEEEEEEcccccEEcccHHHHHHHHHHHHHHcccccccccccHHcHHHHHHHHHHHHccccHHHHcccccccHHHHHHHHccccEEccccccHHHHHccccHHccccccccccccccccccccccHHHHHHHHHccccccccccHHHHHHHHcccccccccccccccccccccccccccccccc
cEEEEcccccccHEEEcccccHHHHHHHHHHcccccccccEEEccHHcHHccEccccccccccccccEEEEEEcccHHHHHHHHHHHHcccHHHccEEEEcccHccccccccccccEEcccccccccccccccccHHHHHHHHHHcccccccEEEEcEEEEccccEEEcccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccccEEccccccHHHHHHHHHHccEcccccccHHHHHHHHEEEccccEEEEEccccHHHHHccHHHHHHHHHHHccccccccccHHHHHHHcccccccccccccEcccccccccccccHHHccc
MIFLFSKTFFAKTSFILslfpfkhsrQMARSAIDEvsetgsftrtaSTFRRfisrdpnsqfpaesgryhlyisyacpwaSRCLAYLKIKGLEKAISftsvkpiweqtketdehrgwvfpatnteepgaepdplngakTIRDLYELAstnysgkftvpvlwdkklktIVNNESAEIIRMFNTEFndiaenasldlhpsdqrdqidgtnewiynginngvyrcgfatkqgpydeilgkqryicgnRLTEADIRLFVTLIRFDEVYAVHFKCNKKLlreypnlfnytkdiyqipsmsstvnmqhikrhyygshpsinpygiiplgpdidyssphdrekfsa
miflfsktffaktsFILSLFPFKHSRQMARSAidevsetgsftrtastfrrfisrdpnsqfPAESGRYHLYISYACPWASRCLAYLKIKGLEKAISFTSVKPIWeqtketdehrgwvfpatnteepgaepdplNGAKTIRDLYELAStnysgkftvpvlwdkklKTIVNNESAEIIRMFNTEFNDIAENASLDLHPSDQRDQIDGTNEWIYNGINNGVYRCGFATKQGPYDEILGKQRYICGNRLTEADIRLFVTLIRFDEVYAVHFKCNKKLLREYPNLFNYTKDIYQIPSMSSTVNMQHIKRHYYGSHPSINPYGIIPLGPDIDYSSPHDREKFSA
MIFLFSKTFFAKTSFILSLFPFKHSRQMARSAIDEVSETGSFTRTASTFRRFISRDPNSQFPAESGRYHLYISYACPWASRCLAYLKIKGLEKAISFTSVKPIWEQTKETDEHRGWVFPATNTEEPGAEPDPLNGAKTIRDLYELASTNYSGKFTVPVLWDKKLKTIVNNESAEIIRMFNTEFNDIAENASLDLHPSDQRDQIDGTNEWIYNGINNGVYRCGFATKQGPYDEILGKQRYICGNRLTEADIRLFVTLIRFDEVYAVHFKCNKKLLREYPNLFNYTKDIYQIPSMSSTVNMQHIKRHYYGSHPSINPYGIIPLGPDIDYSSPHDREKFSA
*IFLFSKTFFAKTSFILSLFPFKH***************************F************SGRYHLYISYACPWASRCLAYLKIKGLEKAISFTSVKPIWEQTKETDEHRGWVFP*****************KTIRDLYELASTNYSGKFTVPVLWDKKLKTIVNNESAEIIRMFNTEFNDIAENAS***********IDGTNEWIYNGINNGVYRCGFATKQGPYDEILGKQRYICGNRLTEADIRLFVTLIRFDEVYAVHFKCNKKLLREYPNLFNYTKDIYQIPSMSSTVNMQHIKRHYYGSHPSINPYGIIPLGPDI*************
********FFAKTSFILSLFPFKHSRQMARS*****S***SFTRTASTFRRFISRDPNSQFPAESGRYHLYISYACPWASRCLAYLKIKGLEKAISFTSVKPIWEQTKETDEHRGWVFPATNTEEPGAEPDPLNGAKTIRDLYELASTNYSGKFTVPVLWDKKLKTIVNNESAEIIRMFNTEFNDIAENASLDLHPSDQRDQIDGTNEWIYNGINNGVYRCGFATKQGPYDEILGKQRYICGNRLTEADIRLFVTLIRFDEVYAVHFKCNKKLLREYPNLFNYTKDIYQIPSMSSTVNMQHIKRHYYGSHPSINPYGIIPLGPDIDYSSPHD******
MIFLFSKTFFAKTSFILSLFPFKHSRQMARSAIDEVSETGSFTRTASTFRRFISRDPNSQFPAESGRYHLYISYACPWASRCLAYLKIKGLEKAISFTSVKPIWEQTKETDEHRGWVFPATNTEEPGAEPDPLNGAKTIRDLYELASTNYSGKFTVPVLWDKKLKTIVNNESAEIIRMFNTEFNDIAENASLDLHPSDQRDQIDGTNEWIYNGINNGVYRCGFATKQGPYDEILGKQRYICGNRLTEADIRLFVTLIRFDEVYAVHFKCNKKLLREYPNLFNYTKDIYQIPSMSSTVNMQHIKRHYYGSHPSINPYGIIPLGPDIDYSS*********
MIFLFSKTFFAKTSFILSLFPFKHSRQMARSAIDEVSETGSFTRTASTFRRFISRDPNSQFPAESGRYHLYISYACPWASRCLAYLKIKGLEKAISFTSVKPIWEQTK*****RGWVFPAT*T*EPGAEPDPLNGAKTIRDLYELASTNYSGKFTVPVLWDKKLKTIVNNESAEIIRMFNTEFNDIAENASLDLHPSDQRDQIDGTNEWIYNGINNGVYRCGFATKQGPYDEILGKQRYICGNRLTEADIRLFVTLIRFDEVYAVHFKCNKKLLREYPNLFNYTKDIYQIPSMSSTVNMQHIKRHYYGSHPSINPYGIIPLGPDIDYSS*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIFLFSKTFFAKTSFILSLFPFKHSRQMARSAIDEVSETGSFTRTASTFRRFISRDPNSQFPAESGRYHLYISYACPWASRCLAYLKIKGLEKAISFTSVKPIWEQTKETDEHRGWVFPATNTEEPGAEPDPLNGAKTIRDLYELASTNYSGKFTVPVLWDKKLKTIVNNESAEIIRMFNTEFNDIAENASLDLHPSDQRDQIDGTNEWIYNGINNGVYRCGFATKQGPYDEILGKQRYICGNRLTEADIRLFVTLIRFDEVYAVHFKCNKKLLREYPNLFNYTKDIYQIPSMSSTVNMQHIKRHYYGSHPSINPYGIIPLGPDIDYSSPHDREKFSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query338 2.2.26 [Sep-21-2011]
P42620328 Glutathionyl-hydroquinone N/A no 0.857 0.884 0.473 3e-76
O94524313 Glutathione S-transferase yes no 0.822 0.888 0.434 1e-60
P36156370 Glutathione S-transferase yes no 0.840 0.767 0.370 7e-49
Q04806366 Glutathione S-transferase no no 0.855 0.789 0.343 9e-40
P48239356 Glutathione S-transferase no no 0.825 0.783 0.316 1e-34
>sp|P42620|YQJG_ECOLI Glutathionyl-hydroquinone reductase YqjG OS=Escherichia coli (strain K12) GN=yqjG PE=1 SV=1 Back     alignment and function desciption
 Score =  285 bits (729), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 152/321 (47%), Positives = 194/321 (60%), Gaps = 31/321 (9%)

Query: 34  DEVSETGSFTRTASTFRRFISRDPNSQ------FPAESGRYHLYISYACPWASRCLAYLK 87
           D  S  G F R+AS FR +++ D          F AE  RYHLY+S ACPWA R L   K
Sbjct: 15  DTKSTGGKFQRSASAFRNWLTADGAPGPTGTGGFIAEKDRYHLYVSLACPWAHRTLIMRK 74

Query: 88  IKGLEKAISFTSVKPIWEQTKETDEHRGWVFPATNTEEPGAEPDPLNGAKTIRDLYELAS 147
           +KGLE  IS + V P+  +        GW F   +   PGA  D L   + +  LY  A 
Sbjct: 75  LKGLEPFISVSVVNPLMLEN-------GWTF---DDSFPGATGDTLYQNEFLYQLYLHAD 124

Query: 148 TNYSGKFTVPVLWDKKLKTIVNNESAEIIRMFNTEFNDIAENASLDLHPSDQRDQIDGTN 207
            +YSG+ TVPVLWDKK  TIV+NESAEIIRMFNT F+ +   A  D +P   + +ID  N
Sbjct: 125 PHYSGRVTVPVLWDKKNHTIVSNESAEIIRMFNTAFDALGAKAG-DYYPPALQTKIDELN 183

Query: 208 EWIYNGINNGVYRCGFATKQGPYDE--------------ILGKQRYICGNRLTEADIRLF 253
            WIY+ +NNGVY+ GFAT Q  YDE              ILG+ RY+ GN+LTEADIRL+
Sbjct: 184 GWIYDTVNNGVYKAGFATSQEAYDEAVAKVFESLARLEQILGQHRYLTGNQLTEADIRLW 243

Query: 254 VTLIRFDEVYAVHFKCNKKLLREYPNLFNYTKDIYQIPSMSSTVNMQHIKRHYYGSHPSI 313
            TL+RFD VY  HFKC+K  + +Y NL+ + +DIYQ+P ++ TVN  HI+ HY+ SH +I
Sbjct: 244 TTLVRFDPVYVTHFKCDKHRISDYLNLYGFLRDIYQMPGIAETVNFDHIRNHYFRSHKTI 303

Query: 314 NPYGIIPLGPDIDYSSPHDRE 334
           NP GII +GP  D   PH R+
Sbjct: 304 NPTGIISIGPWQDLDEPHGRD 324

Escherichia coli (strain K12) (taxid: 83333)
>sp|O94524|GTO2_SCHPO Glutathione S-transferase omega-like 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gto2 PE=3 SV=1 Back     alignment and function description
>sp|P36156|GTO2_YEAST Glutathione S-transferase omega-like 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM4 PE=1 SV=1 Back     alignment and function description
>sp|Q04806|GTO3_YEAST Glutathione S-transferase omega-like 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GTO3 PE=1 SV=1 Back     alignment and function description
>sp|P48239|GTO1_YEAST Glutathione S-transferase omega-like 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GTO1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query338
255566325361 glutathione transferase, putative [Ricin 0.985 0.922 0.788 1e-165
224136622325 predicted protein [Populus trichocarpa] 0.920 0.956 0.809 1e-159
225423716356 PREDICTED: uncharacterized protein yqjG- 1.0 0.949 0.738 1e-156
357475193355 Glutathione S-transferase omega-like pro 0.994 0.946 0.731 1e-155
388522929355 unknown [Medicago truncatula] 0.994 0.946 0.728 1e-154
297737960402 unnamed protein product [Vitis vinifera] 0.931 0.783 0.775 1e-154
79478363356 Intracellular chloride channel-like prot 0.976 0.926 0.740 1e-152
23397330352 unknown protein [Arabidopsis thaliana] 0.976 0.937 0.740 1e-152
357475197325 Glutathione S-transferase omega-like pro 0.917 0.953 0.768 1e-151
449455407325 PREDICTED: glutathionyl-hydroquinone red 0.920 0.956 0.766 1e-150
>gi|255566325|ref|XP_002524149.1| glutathione transferase, putative [Ricinus communis] gi|223536616|gb|EEF38260.1| glutathione transferase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  587 bits (1514), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 280/355 (78%), Positives = 312/355 (87%), Gaps = 22/355 (6%)

Query: 4   LFSKTFFA------KTS--FILSLFPFKHSRQMARSAIDEVSETGSFTRTASTFRRFISR 55
           +FSKT  A      K+S  FILS F FKH  QMARSA+DE+S+TG+F RTASTFR FISR
Sbjct: 5   VFSKTHLAFDPKKRKSSIIFILSSFIFKHHLQMARSALDEMSDTGAFLRTASTFRNFISR 64

Query: 56  DPNSQFPAESGRYHLYISYACPWASRCLAYLKIKGLEKAISFTSVKPIWEQTKETDEHRG 115
           DPNSQFPAESGRYHLY+SYACPWASRCLAYLKIKGL+KAISFTSVKPIWE+TK++DEH G
Sbjct: 65  DPNSQFPAESGRYHLYVSYACPWASRCLAYLKIKGLDKAISFTSVKPIWERTKDSDEHMG 124

Query: 116 WVFPATNTEEPGAEPDPLNGAKTIRDLYELASTNYSGKFTVPVLWDKKLKTIVNNESAEI 175
           WVFPA+ TEEPGAEPDPLNGAK+IR+LYELAS NY GK+TVPVLWDKKLKTIV+NES+EI
Sbjct: 125 WVFPASETEEPGAEPDPLNGAKSIRELYELASANYVGKYTVPVLWDKKLKTIVSNESSEI 184

Query: 176 IRMFNTEFNDIAENASLDLHPSDQRDQIDGTNEWIYNGINNGVYRCGFATKQGPYDE--- 232
           IRMFNTEFND+AENA+LDL+PS  + QI+ TNEW+Y+GINNGVYRCGFA KQGPY+E   
Sbjct: 185 IRMFNTEFNDVAENAALDLYPSHLQVQIEETNEWVYSGINNGVYRCGFAKKQGPYEEAAK 244

Query: 233 -----------ILGKQRYICGNRLTEADIRLFVTLIRFDEVYAVHFKCNKKLLREYPNLF 281
                      ILGKQRYICGN L+EADIRLFVTLIRFDEVYAVHFKCNKKLLREYPNLF
Sbjct: 245 QLYDALDKCEKILGKQRYICGNTLSEADIRLFVTLIRFDEVYAVHFKCNKKLLREYPNLF 304

Query: 282 NYTKDIYQIPSMSSTVNMQHIKRHYYGSHPSINPYGIIPLGPDIDYSSPHDREKF 336
           NYTKDI+Q+P M S+VNM+HIKRHYYGSHPSINP+GIIPLGPD D+SSPHDREKF
Sbjct: 305 NYTKDIFQVPGMRSSVNMEHIKRHYYGSHPSINPFGIIPLGPDTDFSSPHDREKF 359

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224136622|ref|XP_002322375.1| predicted protein [Populus trichocarpa] gi|222869371|gb|EEF06502.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225423716|ref|XP_002277886.1| PREDICTED: uncharacterized protein yqjG-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357475193|ref|XP_003607882.1| Glutathione S-transferase omega-like protein [Medicago truncatula] gi|355508937|gb|AES90079.1| Glutathione S-transferase omega-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|388522929|gb|AFK49526.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|297737960|emb|CBI27161.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|79478363|ref|NP_193723.3| Intracellular chloride channel-like protein [Arabidopsis thaliana] gi|24030218|gb|AAN41287.1| unknown protein [Arabidopsis thaliana] gi|332658839|gb|AEE84239.1| Intracellular chloride channel-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|23397330|gb|AAK44087.2|AF370272_1 unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357475197|ref|XP_003607884.1| Glutathione S-transferase omega-like protein [Medicago truncatula] gi|124301261|gb|ABC75353.2| Intracellular chloride channel [Medicago truncatula] gi|217072638|gb|ACJ84679.1| unknown [Medicago truncatula] gi|355508939|gb|AES90081.1| Glutathione S-transferase omega-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449455407|ref|XP_004145444.1| PREDICTED: glutathionyl-hydroquinone reductase YqjG-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query338
TAIR|locus:2155397325 AT5G45020 [Arabidopsis thalian 0.920 0.956 0.744 2.9e-135
TAIR|locus:2155377350 AT5G44990 "AT5G44990" [Arabido 0.890 0.86 0.688 2.6e-118
TAIR|locus:2134005382 AT4G19880 "AT4G19880" [Arabido 0.875 0.774 0.636 2.6e-102
DICTYBASE|DDB_G0286341324 DDB_G0286341 "putative glutath 0.855 0.891 0.482 8.1e-76
UNIPROTKB|Q9KT09315 VC_1096 "Putative uncharacteri 0.843 0.904 0.481 1.2e-72
TIGR_CMR|VC_1096315 VC_1096 "conserved hypothetica 0.843 0.904 0.481 1.2e-72
UNIPROTKB|Q484K9327 CPS_1775 "Putative uncharacter 0.855 0.883 0.472 1.6e-70
TIGR_CMR|CPS_1775327 CPS_1775 "conserved hypothetic 0.855 0.883 0.472 1.6e-70
UNIPROTKB|P42620328 yqjG "S-glutathionyl-(chloro)h 0.857 0.884 0.476 3.3e-70
ASPGD|ASPL0000045458344 gst3 [Emericella nidulans (tax 0.855 0.840 0.459 7e-70
TAIR|locus:2155397 AT5G45020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1325 (471.5 bits), Expect = 2.9e-135, P = 2.9e-135
 Identities = 242/325 (74%), Positives = 282/325 (86%)

Query:    28 MARSAIDEVSETGSFTRTASTFRRFISRDPNSQFPAESGRYHLYISYACPWASRCLAYLK 87
             MARS +DE SE+G+F RTASTFR F+S+DP+SQFPAESGRYHLYISYACPWA RCL+YLK
Sbjct:     1 MARSGVDETSESGAFVRTASTFRNFVSQDPDSQFPAESGRYHLYISYACPWACRCLSYLK 60

Query:    88 IKGLEKAISFTSVKPIWEQTKETDEHRGWVFPATNTEEPGAEPDPLNGAKTIRDLYELAS 147
             IKGL++AI+F+SV  IW +TKETD+HRGWVFP ++TE PGAEPD LNGAK++R+LYE+AS
Sbjct:    61 IKGLDEAITFSSVHAIWGRTKETDDHRGWVFPDSDTELPGAEPDYLNGAKSVRELYEIAS 120

Query:   148 TNYSGKFTVPVLWDKKLKTIVNNESAEIIRMFNTEFNDIAENASLDLHPSDQRDQIDGTN 207
              NY GK+TVPVLWDKKLKT+VNNES+EIIRMFNTEFN IA+  SLDL+PS  RD I+ TN
Sbjct:   121 PNYEGKYTVPVLWDKKLKTVVNNESSEIIRMFNTEFNGIAKTPSLDLYPSHLRDVINETN 180

Query:   208 EWIYNGINNGVYRCGFATKQGPY--------------DEILGKQRYICGNRLTEADIRLF 253
              W++NGINNGVY+CGFA KQ PY              +E+LGKQRYICGN  TEADIRLF
Sbjct:   181 GWVFNGINNGVYKCGFARKQEPYNEAVNQLYEAVDRCEEVLGKQRYICGNTFTEADIRLF 240

Query:   254 VTLIRFDEVYAVHFKCNKKLLREYPNLFNYTKDIYQIPSMSSTVNMQHIKRHYYGSHPSI 313
             VTLIRFDEVYAVHFKCNK+LLREYPN+FNY KDIYQI  MSSTVNM+HIK+HYYGSHP+I
Sbjct:   241 VTLIRFDEVYAVHFKCNKRLLREYPNIFNYIKDIYQIHGMSSTVNMEHIKQHYYGSHPTI 300

Query:   314 NPYGIIPLGPDIDYSSPHDREKFSA 338
             NP+GIIP GP+IDYSSPHDR++FS+
Sbjct:   301 NPFGIIPHGPNIDYSSPHDRDRFSS 325
GO:0005634 "nucleus" evidence=ISM
GO:0010413 "glucuronoxylan metabolic process" evidence=RCA
GO:0045492 "xylan biosynthetic process" evidence=RCA
TAIR|locus:2155377 AT5G44990 "AT5G44990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2134005 AT4G19880 "AT4G19880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286341 DDB_G0286341 "putative glutathione S-transferase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KT09 VC_1096 "Putative uncharacterized protein" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_1096 VC_1096 "conserved hypothetical protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|Q484K9 CPS_1775 "Putative uncharacterized protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_1775 CPS_1775 "conserved hypothetical protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|P42620 yqjG "S-glutathionyl-(chloro)hydroquinone reductase" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
ASPGD|ASPL0000045458 gst3 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O94524GTO2_SCHPO1, ., 8, ., 5, ., 10.43400.82240.8881yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.5.1.180.824
3rd Layer2.5.10.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query338
COG0435324 COG0435, ECM4, Predicted glutathione S-transferase 1e-144
cd03190142 cd03190, GST_C_Omega_like, C-terminal, alpha helic 6e-74
pfam1341069 pfam13410, GST_C_2, Glutathione S-transferase, C-t 7e-09
pfam1340968 pfam13409, GST_N_2, Glutathione S-transferase, N-t 2e-06
cd00299100 cd00299, GST_C_family, C-terminal, alpha helical d 6e-05
pfam0004392 pfam00043, GST_C, Glutathione S-transferase, C-ter 0.003
>gnl|CDD|223512 COG0435, ECM4, Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  409 bits (1053), Expect = e-144
 Identities = 162/324 (50%), Positives = 210/324 (64%), Gaps = 28/324 (8%)

Query: 31  SAIDEVSETGSFTRTASTFRRFISRD---PNSQFPAESGRYHLYISYACPWASRCLAYLK 87
           S  D  S  G F R++S FR +I+ D       F AE GRYHLY+S ACPWA R L +  
Sbjct: 12  SWYDTKSTDGEFKRSSSQFRNWITADGPPGTGGFKAEKGRYHLYVSLACPWAHRTLIFRA 71

Query: 88  IKGLEKAISFTSVKPIWEQTKETDEHRGWVFPATNTEEPGAEPDPLNGAKTIRDLYELAS 147
           +KGLE  IS + V P+       DE+ GW F   + E PGA  DPL G + +  LY  A 
Sbjct: 72  LKGLEPVISVSVVHPL------MDEN-GWTF---DPEFPGATGDPLYGIERLSQLYTRAD 121

Query: 148 TNYSGKFTVPVLWDKKLKTIVNNESAEIIRMFNTEFNDIAENASLDLHPSDQRDQIDGTN 207
            +YSG+ TVPVLWDKK +TIVNNESAEIIRMFN+ F++   +A +DL+P   R +ID  N
Sbjct: 122 PDYSGRVTVPVLWDKKTQTIVNNESAEIIRMFNSAFDEFGASA-VDLYPEALRTEIDELN 180

Query: 208 EWIYNGINNGVYRCGFATKQGPYDE--------------ILGKQRYICGNRLTEADIRLF 253
           +WIY+ +NNGVY+ GFAT Q  Y+E              IL ++RY+ G++LTEADIRLF
Sbjct: 181 KWIYDTVNNGVYKAGFATTQEAYEEAVKKLFEALDKLEQILSERRYLTGDQLTEADIRLF 240

Query: 254 VTLIRFDEVYAVHFKCNKKLLREYPNLFNYTKDIYQIPSMSSTVNMQHIKRHYYGSHPSI 313
            TL+RFD VY  HFKCN + +R+YPNL+ Y +D+YQ+P  + TV+  HIK HYY SH +I
Sbjct: 241 TTLVRFDPVYVGHFKCNLRRIRDYPNLWGYLRDLYQLPGFAETVDFDHIKLHYYRSHTTI 300

Query: 314 NPYGIIPLGPDIDYSSPHDREKFS 337
           NP GI+PLGP  D  +PH R++  
Sbjct: 301 NPTGIVPLGPKPDLLAPHGRDRLG 324

Length = 324
>gnl|CDD|198299 cd03190, GST_C_Omega_like, C-terminal, alpha helical domain of Class Omega-like Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain Back     alignment and domain information
>gnl|CDD|222110 pfam13409, GST_N_2, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family Back     alignment and domain information
>gnl|CDD|215674 pfam00043, GST_C, Glutathione S-transferase, C-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 338
COG0435324 ECM4 Predicted glutathione S-transferase [Posttran 100.0
KOG2903319 consensus Predicted glutathione S-transferase [Pos 100.0
PRK11752264 putative S-transferase; Provisional 99.95
PRK09481211 sspA stringent starvation protein A; Provisional 99.95
KOG0406231 consensus Glutathione S-transferase [Posttranslati 99.94
PLN02473214 glutathione S-transferase 99.94
PRK13972215 GSH-dependent disulfide bond oxidoreductase; Provi 99.94
PLN02395215 glutathione S-transferase 99.93
PRK10542201 glutathionine S-transferase; Provisional 99.93
COG0625211 Gst Glutathione S-transferase [Posttranslational m 99.92
PRK15113214 glutathione S-transferase; Provisional 99.92
PLN02378213 glutathione S-transferase DHAR1 99.92
TIGR00862236 O-ClC intracellular chloride channel protein. Thes 99.92
KOG0867226 consensus Glutathione S-transferase [Posttranslati 99.9
KOG0868217 consensus Glutathione S-transferase [Posttranslati 99.9
TIGR01262210 maiA maleylacetoacetate isomerase. Maleylacetoacet 99.9
PLN02817265 glutathione dehydrogenase (ascorbate) 99.89
PRK10357202 putative glutathione S-transferase; Provisional 99.89
PRK10387210 glutaredoxin 2; Provisional 99.88
cd03190142 GST_C_ECM4_like GST_C family, ECM4-like subfamily; 99.87
PTZ00057205 glutathione s-transferase; Provisional 99.83
TIGR02182209 GRXB Glutaredoxin, GrxB family. This model include 99.82
KOG4420325 consensus Uncharacterized conserved protein (Gangl 99.68
PLN02907 722 glutamate-tRNA ligase 99.64
PF1340970 GST_N_2: Glutathione S-transferase, N-terminal dom 99.59
KOG1422221 consensus Intracellular Cl- channel CLIC, contains 99.58
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 99.58
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 99.52
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced diff 99.51
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 99.47
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Ch 99.47
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 99.46
cd0304881 GST_N_Ure2p_like GST_N family, Ure2p-like subfamil 99.43
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 99.43
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; compo 99.41
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; c 99.41
cd03198134 GST_C_CLIC GST_C family, Chloride Intracellular Ch 99.4
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 99.4
cd0304475 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo 99.39
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs 99.39
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 99.37
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; compose 99.37
cd0305777 GST_N_Beta GST_N family, Class Beta subfamily; GST 99.37
KOG1695206 consensus Glutathione S-transferase [Posttranslati 99.36
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; compose 99.34
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 99.33
cd0304676 GST_N_GTT1_like GST_N family, Saccharomyces cerevi 99.3
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GST 99.29
cd0303972 GST_N_Sigma_like GST_N family, Class Sigma_like; c 99.27
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; compose 99.26
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 99.26
cd0307673 GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar 99.25
cd0307582 GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar 99.16
cd03185126 GST_C_Tau GST_C family, Class Tau subfamily; GSTs 99.15
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; compose 99.14
cd0307779 GST_N_Alpha GST_N family, Class Alpha subfamily; G 99.14
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase Li 99.14
cd03196115 GST_C_5 GST_C family, unknown subfamily 5; compose 99.14
cd03184124 GST_C_Omega GST_C family, Class Omega subfamily; G 99.13
PF0279876 GST_N: Glutathione S-transferase, N-terminal domai 99.12
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily 99.08
cd03203120 GST_C_Lambda GST_C family, Class Lambda subfamily; 99.08
cd03201121 GST_C_DHAR GST_C family, Dehydroascorbate Reductas 99.06
cd03186107 GST_C_SspA GST_N family, Stringent starvation prot 99.02
cd03188114 GST_C_Beta GST_C family, Class Beta subfamily; GST 99.02
cd03187118 GST_C_Phi GST_C family, Class Phi subfamily; compo 98.99
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 98.98
cd03207103 GST_C_8 GST_C family, unknown subfamily 8; compose 98.93
cd0320096 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed 98.91
cd03210126 GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar 98.9
PF0004395 GST_C: Glutathione S-transferase, C-terminal domai 98.9
cd03178113 GST_C_Ure2p_like GST_C family, Ure2p-like subfamil 98.89
cd03183126 GST_C_Theta GST_C family, Class Theta subfamily; c 98.87
cd03208137 GST_C_Alpha GST_C family, Class Alpha subfamily; G 98.85
cd03177118 GST_C_Delta_Epsilon GST_C family, Class Delta and 98.84
cd03209121 GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar 98.82
cd03181123 GST_C_EFB1gamma GST_C family, Gamma subunit of Elo 98.8
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; com 98.8
cd03191121 GST_C_Zeta GST_C family, Class Zeta subfamily; GST 98.75
cd03180110 GST_C_2 GST_C family, unknown subfamily 2; compose 98.75
cd03204111 GST_C_GDAP1 GST_C family, Ganglioside-induced diff 98.74
cd03189119 GST_C_GTT1_like GST_C family, Saccharomyces cerevi 98.74
COG2999215 GrxB Glutaredoxin 2 [Posttranslational modificatio 98.69
cd03206100 GST_C_7 GST_C family, unknown subfamily 7; compose 98.67
PF1341069 GST_C_2: Glutathione S-transferase, C-terminal dom 98.66
cd03194114 GST_C_3 GST_C family, unknown subfamily 3; compose 98.58
cd03182117 GST_C_GTT2_like GST_C family, Saccharomyces cerevi 98.56
KOG3029370 consensus Glutathione S-transferase-related protei 98.55
cd03195114 GST_C_4 GST_C family, unknown subfamily 4; compose 98.5
cd0319388 GST_C_Metaxin GST_C family, Metaxin subfamily; com 98.37
PF1449799 GST_C_3: Glutathione S-transferase, C-terminal dom 98.34
cd03202124 GST_C_etherase_LigE GST_C family, Beta etherase Li 98.32
cd03197149 GST_C_mPGES2 GST_C family; microsomal Prostaglandi 98.31
KOG4244281 consensus Failed axon connections (fax) protein/gl 98.31
cd0307974 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me 98.29
cd00299100 GST_C_family Glutathione S-transferase (GST) famil 98.19
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 98.16
cd03179105 GST_C_1 GST_C family, unknown subfamily 1; compose 98.12
cd03192104 GST_C_Sigma_like GST_C family, Class Sigma_like; c 97.99
cd03211126 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me 97.89
PRK1063883 glutaredoxin 3; Provisional 97.85
cd0320598 GST_C_6 GST_C family, unknown subfamily 6; compose 97.68
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 97.67
cd03212137 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, 97.65
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 97.52
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 97.48
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 97.44
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 97.42
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 97.29
PRK1032981 glutaredoxin-like protein; Provisional 97.18
KOG3027257 consensus Mitochondrial outer membrane protein Met 97.01
cd0307873 GST_N_Metaxin1_like GST_N family, Metaxin subfamil 96.9
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 96.87
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 96.66
KOG3028313 consensus Translocase of outer mitochondrial membr 96.61
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 96.59
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 96.29
PHA03050108 glutaredoxin; Provisional 96.27
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 96.09
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 95.95
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 95.86
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 95.85
PF14834117 GST_C_4: Glutathione S-transferase, C-terminal dom 95.57
PRK1120085 grxA glutaredoxin 1; Provisional 95.41
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 94.55
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 93.44
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 91.68
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknow 88.35
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 87.93
PF1056872 Tom37: Outer mitochondrial membrane transport comp 87.87
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 86.73
KOG1147 712 consensus Glutamyl-tRNA synthetase [Translation, r 86.26
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 85.92
PRK01655131 spxA transcriptional regulator Spx; Reviewed 85.02
PRK10824115 glutaredoxin-4; Provisional 83.19
TIGR01617117 arsC_related transcriptional regulator, Spx/MgsR f 82.54
PRK12759 410 bifunctional gluaredoxin/ribonucleoside-diphosphat 82.38
cd03032115 ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub 81.16
PF09635122 MetRS-N: MetRS-N binding domain; InterPro: IPR0182 80.67
>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.7e-93  Score=651.18  Aligned_cols=296  Identities=53%  Similarity=0.996  Sum_probs=283.4

Q ss_pred             ccccccCCCCceecCCCcccccccCCCCCC---CCCCCCcEEEEeeCCCchhhHHHHHHHHhCCCceeeeeeeCCccccc
Q 019639           31 SAIDEVSETGSFTRTASTFRRFISRDPNSQ---FPAESGRYHLYISYACPWASRCLAYLKIKGLEKAISFTSVKPIWEQT  107 (338)
Q Consensus        31 ~~~~~~~~~g~~~r~~~~f~~~i~~~~~~~---~~~e~gry~LY~~~~cP~a~Rv~i~l~lkGLe~~i~v~~v~~~~~~~  107 (338)
                      .-+++.+.+|+|+|+.|+||+||++|++.+   |+||+||||||||.+||||||++|+++|||||++|+|++|+|.+.++
T Consensus        12 ~~~d~~~~~G~F~R~~s~fR~~i~~d~~~g~~~f~~e~GRYhLYvslaCPWAHRTLI~R~LkgLE~~Isvsvv~~~m~~~   91 (324)
T COG0435          12 SWYDTKSTDGEFKRSSSQFRNWITADGPPGTGGFKAEKGRYHLYVSLACPWAHRTLIFRALKGLEPVISVSVVHPLMDEN   91 (324)
T ss_pred             hccccccCCCcEEeccchhhceeecCCCCCcCCcCCCCCeEEEEEEecCchHHHHHHHHHHhcccccceEEEecccccCC
Confidence            346678889999999999999999888664   99999999999999999999999999999999999999999999988


Q ss_pred             cccccCCCccccCCCCCCCCCCCCCCCCCCcchHHHHhhCCCCCCCccccEEEECCCCceecchHHHHHHHHhhccCccc
Q 019639          108 KETDEHRGWVFPATNTEEPGAEPDPLNGAKTIRDLYELASTNYSGKFTVPVLWDKKLKTIVNNESAEIIRMFNTEFNDIA  187 (338)
Q Consensus       108 ~~~~~~~gW~f~~~~~~~~g~~~d~~~g~~~l~e~Yl~~nP~y~Gr~tVPvL~D~~~g~ivl~ES~aI~~YL~~~f~~~~  187 (338)
                             ||.|.+.   .+|++.||++|.++|++.|.+..|.|+||.|||||||+++.+||+|||++|+++|+.+|++++
T Consensus        92 -------GW~F~~~---~~g~t~dpl~g~~~L~~~Y~~adP~YsgRvTVPVLwDk~~~tIVnNES~eIirm~N~aFde~~  161 (324)
T COG0435          92 -------GWTFDPE---FPGATGDPLYGIERLSQLYTRADPDYSGRVTVPVLWDKKTQTIVNNESAEIIRMFNSAFDEFG  161 (324)
T ss_pred             -------CceEcCC---CCCCCCCcccchhHHHHHHhhcCCCCCCceeEEEEEecCCCeeecCCcHHHHHHHHHHHHHHh
Confidence                   9999874   478999999999999999999999999999999999999999999999999999999999887


Q ss_pred             cccCCCCCCcchHHHHHHHHHHHHhhhhhhhhhccccCCcccHH--------------HhhCCCceeccCccchhhhhHH
Q 019639          188 ENASLDLHPSDQRDQIDGTNEWIYNGINNGVYRCGFATKQGPYD--------------EILGKQRYICGNRLTEADIRLF  253 (338)
Q Consensus       188 ~~~~~~L~P~~~~~~id~~~~~i~~~i~~~vy~~~fa~~q~a~e--------------~~L~~~~yL~Gd~~TlADI~L~  253 (338)
                      .+ ..+|||++++.+||++++|||..+|||||++|||++|++||              ++|++++||+||++|+|||+||
T Consensus       162 ~~-~~dlyP~~Lr~eId~~n~~Iy~~vNNGVYk~GFA~tq~aYeea~~~lF~~Ld~lE~~L~~~ryl~Gd~lTEAD~RLf  240 (324)
T COG0435         162 AS-AVDLYPEALRTEIDELNKWIYDTVNNGVYKAGFATTQEAYEEAVKKLFEALDKLEQILSERRYLTGDQLTEADIRLF  240 (324)
T ss_pred             hh-ccccCCHHHHHHHHHHHhhhcccccCceeeecccchHHHHHHHHHHHHHHHHHHHHHhhcCeeeccccchHhhhhhh
Confidence            65 68999999999999999999999999999999999999876              7888999999999999999999


Q ss_pred             HHHHHHHHHHHhHhhccccCCCCCHHHHHHHHHHhCChhHHHhhchhHHHHHHhccCCCCCCCCeeeCCCCCCCCCCCCc
Q 019639          254 VTLIRFDEVYAVHFKCNKKLLREYPNLFNYTKDIYQIPSMSSTVNMQHIKRHYYGSHPSINPYGIIPLGPDIDYSSPHDR  333 (338)
Q Consensus       254 p~L~r~~~vy~~~f~~~~~~l~~yPnL~aw~~rl~~rPa~~~t~~~~~i~~~Y~~s~~~~np~~ivp~gp~~~~~~~~~r  333 (338)
                      +||.|||+||++|||||.++|.+||||+.|++.|++.|+|++|++++|||.|||.||..|||.||||.||.+|+..||+|
T Consensus       241 tTlvRFD~VYvgHFKCN~~rI~dypnL~~yLr~LYq~pg~~~T~df~hIK~hYyrSh~~INPtgIvP~GP~~d~~~~h~r  320 (324)
T COG0435         241 TTLVRFDPVYVGHFKCNLRRIRDYPNLWGYLRDLYQLPGFAETVDFDHIKLHYYRSHTTINPTGIVPLGPKPDLLAPHGR  320 (324)
T ss_pred             heeEeecceEEeeeecccchhhcCchHHHHHHHHhcCcccccccchhHhhhhheecccccCCCceecCCCCccccCCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccC
Q 019639          334 EKFS  337 (338)
Q Consensus       334 ~~~~  337 (338)
                      ++|+
T Consensus       321 ~~~~  324 (324)
T COG0435         321 DRLG  324 (324)
T ss_pred             cccC
Confidence            9985

>KOG2903 consensus Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>PLN02395 glutathione S-transferase Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>KOG0867 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0868 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>KOG4420 consensus Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1) [Function unknown] Back     alignment and domain information
>PLN02907 glutamate-tRNA ligase Back     alignment and domain information
>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B Back     alignment and domain information
>KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>KOG1695 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs Back     alignment and domain information
>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant Back     alignment and domain information
>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene Back     alignment and domain information
>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B Back     alignment and domain information
>cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>KOG3029 consensus Glutathione S-transferase-related protein [General function prediction only] Back     alignment and domain information
>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B Back     alignment and domain information
>cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>KOG4244 consensus Failed axon connections (fax) protein/glutathione S-transferase-like protein [Signal transduction mechanisms] Back     alignment and domain information
>cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha Back     alignment and domain information
>cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>KOG3027 consensus Mitochondrial outer membrane protein Metaxin 2, Metaxin 1-binding protein [Cell wall/membrane/envelope biogenesis; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>KOG3028 consensus Translocase of outer mitochondrial membrane complex, subunit TOM37/Metaxin 1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>KOG1147 consensus Glutamyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>PRK01655 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes Back     alignment and domain information
>PF09635 MetRS-N: MetRS-N binding domain; InterPro: IPR018285 This entry represents the N-terminal domain of methionyl-tRNA synthetase (MetRS) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query338
3r3e_A328 The Glutathione Bound Structure Of Yqjg, A Glutathi 2e-77
3ppu_A352 Crystal Structure Of The Glutathione-S-Transferase 4e-75
4fqu_A313 Glutathionyl-hydroquinone Reductase Pcpf Of Sphingo 7e-64
3m1g_A362 The Structure Of A Putative Glutathione S-Transfera 3e-48
>pdb|3R3E|A Chain A, The Glutathione Bound Structure Of Yqjg, A Glutathione Transferase Homolog From Escherichia Coli K-12 Length = 328 Back     alignment and structure 
Iteration: 1

 Score =  285 bits (729), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 152/321 (47%), Positives = 194/321 (60%), Gaps = 31/321 (9%)
Query: 34  DEVSETGSFTRTASTFRRFISRDPNSQ------FPAESGRYHLYISYACPWASRCLAYLK 87
           D  S  G F R+AS FR +++ D          F AE  RYHLY+S ACPWA R L   K
Sbjct: 15  DTKSTGGKFQRSASAFRNWLTADGAPGPTGTGGFIAEKDRYHLYVSLACPWAHRTLIMRK 74
Query: 88  IKGLEKAISFTSVKPIWEQTKETDEHRGWVFPATNTEEPGAEPDPLNGAKTIRDLYELAS 147
           +KGLE  IS + V P+  +        GW F   +   PGA  D L   + +  LY  A 
Sbjct: 75  LKGLEPFISVSVVNPLMLEN-------GWTF---DDSFPGATGDTLYQNEFLYQLYLHAD 124
Query: 148 TNYSGKFTVPVLWDKKLKTIVNNESAEIIRMFNTEFNDIAENASLDLHPSDQRDQIDGTN 207
            +YSG+ TVPVLWDKK  TIV+NESAEIIRMFNT F+ +   A  D +P   + +ID  N
Sbjct: 125 PHYSGRVTVPVLWDKKNHTIVSNESAEIIRMFNTAFDALGAKAG-DYYPPALQTKIDELN 183
Query: 208 EWIYNGINNGVYRCGFATKQGPYDE--------------ILGKQRYICGNRLTEADIRLF 253
            WIY+ +NNGVY+ GFAT Q  YDE              ILG+ RY+ GN+LTEADIRL+
Sbjct: 184 GWIYDTVNNGVYKAGFATSQEAYDEAVAKVFESLARLEQILGQHRYLTGNQLTEADIRLW 243
Query: 254 VTLIRFDEVYAVHFKCNKKLLREYPNLFNYTKDIYQIPSMSSTVNMQHIKRHYYGSHPSI 313
            TL+RFD VY  HFKC+K  + +Y NL+ + +DIYQ+P ++ TVN  HI+ HY+ SH +I
Sbjct: 244 TTLVRFDPVYVTHFKCDKHRISDYLNLYGFLRDIYQMPGIAETVNFDHIRNHYFRSHKTI 303
Query: 314 NPYGIIPLGPDIDYSSPHDRE 334
           NP GII +GP  D   PH R+
Sbjct: 304 NPTGIISIGPWQDLDEPHGRD 324
>pdb|3PPU|A Chain A, Crystal Structure Of The Glutathione-S-Transferase Xi From Phanerochaete Chrysosporium Length = 352 Back     alignment and structure
>pdb|4FQU|A Chain A, Glutathionyl-hydroquinone Reductase Pcpf Of Sphingobium Chlorophenolicum Length = 313 Back     alignment and structure
>pdb|3M1G|A Chain A, The Structure Of A Putative Glutathione S-Transferase From Corynebacterium Glutamicum Length = 362 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query338
3m1g_A362 Putative glutathione S-transferase; ECM4-like subf 1e-155
3r3e_A328 Uncharacterized protein YQJG; thioredoxin domain, 1e-154
3ppu_A352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 1e-150
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 4e-15
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 2e-09
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 2e-07
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 1e-06
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 1e-06
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 3e-06
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 9e-06
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 1e-05
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 2e-05
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 2e-05
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 2e-05
3lxz_A229 Glutathione S-transferase family protein; structur 3e-05
2fhe_A216 GST, glutathione S-transferase; transferase-substr 4e-05
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 5e-05
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 5e-05
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 7e-05
1axd_A209 Glutathione S-transferase I; transferase, herbicid 1e-04
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 1e-04
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 3e-04
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 4e-04
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 4e-04
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 4e-04
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 6e-04
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 7e-04
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Length = 362 Back     alignment and structure
 Score =  438 bits (1128), Expect = e-155
 Identities = 110/336 (32%), Positives = 163/336 (48%), Gaps = 39/336 (11%)

Query: 30  RSAIDEVSETGSFTRTASTFRRFISRDPNS------------QFPAESGRYHLYISYACP 77
             A    S  G F R  +     I  D  +             +P E+GRY L  + ACP
Sbjct: 12  AGAPQNASADGEFVRDTNYIDDRIVADVPAGSEPIAQEDGTFHWPVEAGRYRLVAARACP 71

Query: 78  WASRCLAYLKIKGLEKAISFTSVKPIWEQTKETDEHRGWVFPATNTEEPGAEPDPLNGAK 137
           WA R +   ++ GLE  IS     P       T + R W F     +      DP+    
Sbjct: 72  WAHRTVITRRLLGLENVISLGLTGP-------THDVRSWTF-----DLDPNHLDPVLQIP 119

Query: 138 TIRDLYELASTNYSGKFTVPVLWDKKLKTIVNNESAEIIRMFNTEFNDIAENASLDLHPS 197
            ++D Y     +Y    TVP L ++  K +V N+   I   FN E+       + +L+P+
Sbjct: 120 RLQDAYFNRFPDYPRGITVPALVEESSKKVVTNDYPSITIDFNLEWKQFHREGAPNLYPA 179

Query: 198 DQRDQIDGTNEWIYNGINNGVYRCGFATKQGPYDE--------------ILGKQRYICGN 243
           + R+++    + I+  +NNGVYR GFA  Q  ++E               L  +RY+ G+
Sbjct: 180 ELREEMAPVMKRIFTEVNNGVYRTGFAGSQEAHNEAYKRLWVALDWLEDRLSTRRYLMGD 239

Query: 244 RLTEADIRLFVTLIRFDEVYAVHFKCNKKLLREYPNLFNYTKDIYQIPSMSSTVNMQHIK 303
            +TEADIRL+ TL+RFD VY  HFKC +  + E PNL+ Y +D++Q P    T +   IK
Sbjct: 240 HITEADIRLYPTLVRFDAVYHGHFKCGRNKITEMPNLWGYLRDLFQTPGFGDTTDFTEIK 299

Query: 304 RHYYGSHPSINPYGIIPLGPDID-YSSPHDREKFSA 338
           +HYY +H  INP  I+P+GPD+  +++PH REK   
Sbjct: 300 QHYYITHAEINPTRIVPVGPDLSGFATPHGREKLGG 335
>3r3e_A Uncharacterized protein YQJG; thioredoxin domain, GST, glutathione transferase, glutathion disulfide bond reductase, transferase; HET: GSH; 2.21A {Escherichia coli} Length = 328 Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Length = 352 Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Length = 291 Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Length = 174 Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Length = 198 Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Length = 218 Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Length = 234 Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Length = 224 Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Length = 254 Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Length = 280 Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Length = 216 Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Length = 218 Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Length = 219 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Length = 210 Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Length = 202 Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Length = 206 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query338
4g0i_A328 Protein YQJG; glutathionyl-hydroquinone reductase, 100.0
4fqu_A313 Putative glutathione transferase; glutathionyl-hyd 100.0
3m1g_A362 Putative glutathione S-transferase; ECM4-like subf 100.0
3ppu_A352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 100.0
4g10_A265 Glutathione S-transferase homolog; thioredoxin fol 100.0
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 99.97
4hoj_A210 REGF protein; GST, glutathione S-transferase, enzy 99.97
4hi7_A228 GI20122; GST, glutathione S-transferase, enzyme fu 99.97
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 99.97
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 99.96
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 99.96
4glt_A225 Glutathione S-transferase-like protein; structural 99.96
3vk9_A216 Glutathione S-transferase delta; glutathione bindi 99.96
4gci_A211 Glutathione S-transferase; GST, enzyme function in 99.96
4gf0_A215 Glutathione S-transferase; GST, enzyme function in 99.96
3lyp_A215 Stringent starvation protein A; structural genomic 99.95
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 99.95
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 99.95
2ahe_A267 Chloride intracellular channel protein 4; glutathi 99.95
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 99.95
3lxz_A229 Glutathione S-transferase family protein; structur 99.95
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 99.95
3n5o_A235 Glutathione transferase; seattle structural genomi 99.95
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 99.95
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 99.95
4ikh_A244 Glutathione S-transferase; enzyme function initiat 99.95
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 99.95
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 99.95
3lyk_A216 Stringent starvation protein A homolog; structural 99.95
3niv_A222 Glutathione S-transferase; structural genomics, PS 99.95
4iel_A229 Glutathione S-transferase, N-terminal domain PROT; 99.95
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 99.95
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 99.95
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 99.95
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 99.95
1r5a_A218 Glutathione transferase; glutathione S-transferase 99.95
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 99.95
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 99.95
4dej_A231 Glutathione S-transferase related protein; transfe 99.95
1axd_A209 Glutathione S-transferase I; transferase, herbicid 99.95
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 99.95
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 99.95
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 99.95
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 99.95
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 99.95
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 99.95
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 99.94
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 99.94
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 99.94
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 99.94
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 99.94
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 99.94
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 99.94
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 99.94
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 99.94
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 99.94
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 99.94
4hz2_A230 Glutathione S-transferase domain; glutathione,enzy 99.94
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 99.94
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 99.94
4exj_A238 Uncharacterized protein; transferase-like protein, 99.94
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 99.94
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 99.94
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 99.94
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 99.94
3tou_A226 Glutathione S-transferase protein; GSH binding sit 99.94
4ecj_A244 Glutathione S-transferase; transferase-like protei 99.94
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 99.94
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 99.94
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 99.94
2r4v_A247 XAP121, chloride intracellular channel protein 2; 99.94
4hz4_A217 Glutathione-S-transferase; enzyme function initiat 99.94
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 99.93
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 99.93
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 99.93
1f2e_A201 Glutathione S-transferase; GST complexed with glut 99.93
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 99.93
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 99.93
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 99.93
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 99.93
4id0_A214 Glutathione S-transferase-like protein YIBF; GST, 99.93
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 99.93
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 99.93
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 99.93
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 99.93
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 99.93
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 99.93
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 99.93
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 99.93
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 99.92
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 99.92
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 99.92
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 99.92
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 99.92
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 99.92
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 99.92
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 99.92
2fhe_A216 GST, glutathione S-transferase; transferase-substr 99.92
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 99.92
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 99.92
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 99.92
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 99.91
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 99.91
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 99.91
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 99.9
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 99.89
3ic8_A310 Uncharacterized GST-like proteinprotein; glutathio 99.89
2fno_A248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 99.88
1z9h_A290 Membrane-associated prostaglandin E synthase-2; me 99.86
4f03_A253 Glutathione transferase; GST fold; 1.80A {Phaneroc 99.86
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 99.84
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.79
2hra_A209 Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l 99.77
2hsn_A160 Methionyl-tRNA synthetase, cytoplasmic; protein co 99.62
2hqt_A124 GU4 nucleic-binding protein 1; GST-fold, biosynthe 98.58
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 98.23
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 98.04
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 97.96
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 97.92
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 97.83
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 97.77
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 97.54
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 97.35
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 97.19
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 96.94
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 96.9
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 96.41
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 96.12
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 95.8
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 95.53
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 95.47
1kte_A105 Thioltransferase; redox-active center, electron tr 95.4
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 95.4
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 95.4
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 95.3
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 95.24
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 95.06
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 94.9
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 94.86
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 94.73
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 94.51
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 94.41
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 94.25
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein 93.92
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 93.71
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 92.9
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 92.5
1ttz_A87 Conserved hypothetical protein; structural genomic 92.28
2axo_A270 Hypothetical protein ATU2684; alpha beta protein., 90.1
1z3e_A132 Regulatory protein SPX; bacterial transcription re 89.11
2kok_A120 Arsenate reductase; brucellosis, zoonotic, oxidore 88.36
3l78_A120 Regulatory protein SPX; transcription, transcripti 87.29
2jad_A362 Yellow fluorescent protein glutaredoxin fusion pro 87.25
1rw1_A114 Conserved hypothetical protein YFFB; thioredoxin f 87.09
3fz4_A120 Putative arsenate reductase; APC61768, structural 83.71
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 82.61
2wul_A118 Glutaredoxin related protein 5; chromosome 14 open 82.5
3gkx_A120 Putative ARSC family related protein; ARSC family 82.45
1s3c_A141 Arsenate reductase; ARSC, arsenite, oxidoreductase 82.18
>4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* Back     alignment and structure
Probab=100.00  E-value=9.2e-86  Score=632.92  Aligned_cols=292  Identities=51%  Similarity=0.921  Sum_probs=275.2

Q ss_pred             ccccCCCCceecCCCcccccccCC------CCCCCCCCCCcEEEEeeCCCchhhHHHHHHHHhCCCceeeeeeeCCcccc
Q 019639           33 IDEVSETGSFTRTASTFRRFISRD------PNSQFPAESGRYHLYISYACPWASRCLAYLKIKGLEKAISFTSVKPIWEQ  106 (338)
Q Consensus        33 ~~~~~~~g~~~r~~~~f~~~i~~~------~~~~~~~e~gry~LY~~~~cP~a~Rv~i~l~lkGLe~~i~v~~v~~~~~~  106 (338)
                      +++.+++|+|+|+.|+||+||++|      ++++||||+||||||+|.+|||||||+|+|+|||||+.|+++++++.+++
T Consensus        14 ~~~~~~~g~f~r~~~~fr~~i~~d~~~~~~~~~~fp~e~gry~Ly~s~~CPwAhR~~I~~~lkGLe~~I~~~vv~~~~~~   93 (328)
T 4g0i_A           14 YDTKSTGGKFQRSASAFRNWLTADGAPGPTGTGGFIAEKDRYHLYVSLACPWAHRTLIMRKLKGLEPFISVSVVNPLMLE   93 (328)
T ss_dssp             TTSCSSSCSSCSSGGGGBCCCBSSSCCCSSSCSCCBCCTTSEEEEECSSCHHHHHHHHHHHHTTCTTTEEEEECCSCCBT
T ss_pred             ccCCCCCCceeCCccccccccccCCCCCCCCCCCCCCCCCcEEEEEeCCCcHHHHHHHHHHHhCCCcceeEEEeCCccCC
Confidence            457789999999999999999988      45789999999999999999999999999999999999999999998877


Q ss_pred             ccccccCCCccccCCCCCCCCCCCCCCCCCCcchHHHHhhCCCCCCCccccEEEECCCCceecchHHHHHHHHhhccCcc
Q 019639          107 TKETDEHRGWVFPATNTEEPGAEPDPLNGAKTIRDLYELASTNYSGKFTVPVLWDKKLKTIVNNESAEIIRMFNTEFNDI  186 (338)
Q Consensus       107 ~~~~~~~~gW~f~~~~~~~~g~~~d~~~g~~~l~e~Yl~~nP~y~Gr~tVPvL~D~~~g~ivl~ES~aI~~YL~~~f~~~  186 (338)
                      .       ||.|+..   .+|+++||++|.++|+|.|++.||.|+||+|||||||+++|+||+|||.+|++||+++|+++
T Consensus        94 ~-------gW~f~~~---~~g~~~d~~~~~~~l~e~Y~~~~p~y~gr~tVPvL~D~~~~~IV~nES~~IiryL~~~f~~~  163 (328)
T 4g0i_A           94 N-------GWTFDDS---FPGATGDTLYQNEFLYQLYLHADPHYSGRVTVPVLWDKKNHTIVSNESAEIIRMFNTAFDAL  163 (328)
T ss_dssp             T-------BSBCCCC---STTCCCCTTTCCSBHHHHHHHHCTTCCBCCCSCEEEETTTTEEEECCHHHHHHHHHHTTGGG
T ss_pred             C-------CCcccCC---CCCCCCCcccCcchHHHHHHhhCCCCCCCceeeEEEECCCCcEEecCHHHHHHHHHHhcccc
Confidence            6       9999764   36899999999999999999999999999999999999999999999999999999999876


Q ss_pred             ccccCCCCCCcchHHHHHHHHHHHHhhhhhhhhhccccCCcccHH--------------HhhCCCceeccCccchhhhhH
Q 019639          187 AENASLDLHPSDQRDQIDGTNEWIYNGINNGVYRCGFATKQGPYD--------------EILGKQRYICGNRLTEADIRL  252 (338)
Q Consensus       187 ~~~~~~~L~P~~~~~~id~~~~~i~~~i~~~vy~~~fa~~q~a~e--------------~~L~~~~yL~Gd~~TlADI~L  252 (338)
                      ... ..+++|..+++++++|++|++..+++++|+++|+.+|++|+              ++|++++||+||++|+|||+|
T Consensus       164 ~~~-~~Dlyp~~lr~~Id~~~~~i~~~inngvy~~gfA~~qeaye~a~~~l~~~Ld~LE~~La~~~YL~Gd~~TlADI~L  242 (328)
T 4g0i_A          164 GAK-AGDYYPPALQTKIDELNGWIYDTVNNGVYKAGFATSQEAYDEAVAKVFESLARLEQILGQHRYLTGNQLTEADIRL  242 (328)
T ss_dssp             TCC-SCCSSCGGGHHHHHHHHHHHHHHTTTTHHHHHTCCSHHHHHHHHHHHHHHHHHHHHHTTTSSSSSSSSCCHHHHHH
T ss_pred             cCC-CCCCCCHHHHHHHHHHHHHHHHHhhhhhhhccccCCHHHHHHHHHHHHHHHHHHHHhhcCCCeecCCCCcHHHHHH
Confidence            543 46899999999999999999999999999999999987764              888899999999999999999


Q ss_pred             HHHHHHHHHHHHhHhhccccCCCCCHHHHHHHHHHhCChhHHHhhchhHHHHHHhccCCCCCCCCeeeCCCCCCCCCCCC
Q 019639          253 FVTLIRFDEVYAVHFKCNKKLLREYPNLFNYTKDIYQIPSMSSTVNMQHIKRHYYGSHPSINPYGIIPLGPDIDYSSPHD  332 (338)
Q Consensus       253 ~p~L~r~~~vy~~~f~~~~~~l~~yPnL~aw~~rl~~rPa~~~t~~~~~i~~~Y~~s~~~~np~~ivp~gp~~~~~~~~~  332 (338)
                      ||||.||+.+|+.+|+|+...+++||||++|+++|+++|+|++|++++|||+|||.||+.|||+||||+||++||.+|||
T Consensus       243 ~ptL~Rfd~vy~~~fk~n~~~i~dyP~L~~w~~~l~q~P~~~~T~~~~~ik~~y~~~~~~~np~~ivp~gp~~~~~~ph~  322 (328)
T 4g0i_A          243 WTTLVRFDPVYVTHFKCDKHRISDYLNLYGFLRDIYQMPGIAETVNFDHIRNHYFRSHKTINPTGIISIGPWQDLDEPHG  322 (328)
T ss_dssp             HHHHHHHTTTTTTTTCCCSCCGGGCHHHHHHHHHHHTSTTTGGGCCHHHHHHHHHHHCTTTCTTCCCCCCCCCCTTSCCC
T ss_pred             HHHHHHHHhhhhhhcCCCccccccChHHHHHHHHHhcchHHHHhCCHHHHHHhhhccCccCCCCcccCCCCCccccCCCC
Confidence            99999999999999999998899999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCc
Q 019639          333 REK  335 (338)
Q Consensus       333 r~~  335 (338)
                      ||.
T Consensus       323 r~~  325 (328)
T 4g0i_A          323 RDV  325 (328)
T ss_dssp             HHH
T ss_pred             hhh
Confidence            983
>4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Back     alignment and structure
>2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 Back     alignment and structure
>1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A Back     alignment and structure
>2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} Back     alignment and structure
>3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 Back     alignment and structure
>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Back     alignment and structure
>1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 Back     alignment and structure
>3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} Back     alignment and structure
>3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 Back     alignment and structure
>1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 338
d1k0ma1149 a.45.1.1 (A:92-240) Chloride intracellular channel 7e-23
d2hrkb1118 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, 3e-19
d2gsta1133 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norv 1e-12
d1gsua1133 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus 5e-08
d3gtub1140 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapi 1e-06
d2c4ja1133 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapi 3e-06
d1duga1140 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma j 1e-05
d1v2aa1125 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Ano 1e-05
d2fhea1136 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepa 3e-05
d1k0da1151 a.45.1.1 (A:201-351) Yeast prion protein ure2p, ni 2e-04
d1tu7a1131 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvu 9e-04
d1eema1139 a.45.1.1 (A:103-241) Class omega GST {Human (Homo 0.002
d1b48a1143 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus mu 0.003
d1gula1140 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo s 0.003
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure

class: All alpha proteins
fold: GST C-terminal domain-like
superfamily: GST C-terminal domain-like
family: Glutathione S-transferase (GST), C-terminal domain
domain: Chloride intracellular channel 1 (clic1)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 91.0 bits (225), Expect = 7e-23
 Identities = 23/140 (16%), Positives = 48/140 (34%), Gaps = 6/140 (4%)

Query: 169 NNESAEIIRMFNTEFNDIAENASLDLHPSDQRDQIDGTNEWIYNGINNGVYRCGFATKQG 228
           N ES         +F+   +N++  L+ + ++  +           +          +  
Sbjct: 9   NPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTS---PLPEGVDETS 65

Query: 229 PYDEILGKQRYICGNRLTEADIRLFVTLIRFDEVYAVHFKCNKKLLREYPNLFNYTKDIY 288
             DE + +++++ GN LT AD  L   L     V          +   +  +  Y  + Y
Sbjct: 66  AEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVC--KKYRGFTIPEAFRGVHRYLSNAY 123

Query: 289 QIPSMSSTVN-MQHIKRHYY 307
                +ST    + I+  Y 
Sbjct: 124 AREEFASTCPDDEEIELAYE 143
>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 118 Back     information, alignment and structure
>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 133 Back     information, alignment and structure
>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Length = 133 Back     information, alignment and structure
>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Length = 140 Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 125 Back     information, alignment and structure
>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 136 Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 151 Back     information, alignment and structure
>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 131 Back     information, alignment and structure
>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 143 Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 140 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query338
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 99.72
d1jlva284 Class delta GST {Mosquito (Anopheles dirus b), iso 99.71
d1r5aa285 Class delta GST {Mosquito (Anopheles dirus b), iso 99.7
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.69
d1gnwa284 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.69
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 99.69
d1e6ba280 Class zeta GST {Mouse-ear cress (Arabidopsis thali 99.68
d1axda280 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.68
d1aw9a281 Class phi GST {Maize (Zea mays), type III [TaxId: 99.67
d1oyja284 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 99.66
d1fw1a283 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.65
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.63
d1k0ma1149 Chloride intracellular channel 1 (clic1) {Human (H 99.6
d1gwca283 Class tau GST {Aegilops tauschii, also known as Tr 99.58
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 99.56
d1gwca1138 Class tau GST {Aegilops tauschii, also known as Tr 99.54
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 99.53
d1eema1139 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.53
d1pmta280 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.52
d1n2aa280 Class beta GST {Escherichia coli [TaxId: 562]} 99.51
d1f2ea280 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.5
d1aw9a1135 Class phi GST {Maize (Zea mays), type III [TaxId: 99.45
d1axda1129 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.43
d1n2aa1121 Class beta GST {Escherichia coli [TaxId: 562]} 99.43
d1k0da1151 Yeast prion protein ure2p, nitrogen regulation fra 99.42
d1pmta1121 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.41
d1ljra1165 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.4
d1f2ea1121 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.38
d2hrkb1118 GU4 nucleic-binding protein 1, Arc1p {Baker's yeas 99.37
d1e6ba1133 Class zeta GST {Mouse-ear cress (Arabidopsis thali 99.34
d1z9ha2113 Microsomal prostaglandin E synthase-2 {Crab-eating 99.33
d1jlva1123 Class delta GST {Mosquito (Anopheles dirus b), iso 99.33
d1fw1a1125 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.32
d2cvda1124 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.32
d1gnwa1126 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.32
d1v2aa1125 Class delta GST {Mosquito (Anopheles dirus b), iso 99.3
d2gsqa1127 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.29
d1jlwa1127 Class delta GST {Mosquito (Anopheles dirus b), iso 99.29
d1nhya275 GST-like domain of elongation factor 1-gamma {Bake 99.27
d1gula277 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.27
d2cvda274 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.27
d2a2ra1132 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 99.26
d2a2ra277 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1r5aa1129 Class delta GST {Mosquito (Anopheles dirus b), iso 99.25
d2c4ja284 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.24
d2fnoa287 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 99.24
d1gula1140 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.23
d1nhya1144 GST-like domain of elongation factor 1-gamma {Bake 99.23
d1b48a278 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 99.23
d1tu7a277 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 99.21
d1k3ya1142 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.21
d2gsqa275 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.21
d1b48a1143 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 99.2
d3gtub1140 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.19
d1k3ya279 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.18
d1m0ua276 Class sigma GST {Fruit fly (Drosophila melanogaste 99.14
d2gsta1133 Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 99.12
d1okta285 Pf GST {Malarial parasite (Plasmodium falciparum) 99.12
d1duga1140 Class alpha GST {Schistosoma japonicum [TaxId: 618 99.11
d2c4ja1133 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1m0ua1127 Class sigma GST {Fruit fly (Drosophila melanogaste 99.08
d1gsua1133 Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 99.07
d2fhea1136 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 99.02
d1oyja1145 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 98.98
d1tw9a277 Class sigma GST {Heligmosomoides polygyrus [TaxId: 98.95
d1okta1126 Pf GST {Malarial parasite (Plasmodium falciparum) 98.94
d1tu7a1131 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 98.93
d1tw9a1129 Class sigma GST {Heligmosomoides polygyrus [TaxId: 98.9
d1duga280 Class alpha GST {Schistosoma japonicum [TaxId: 618 98.79
d1fhea280 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 98.75
d1oe8a1123 Class alpha GST {Blood fluke (Schistosoma haematob 98.52
d1oe8a281 Class alpha GST {Blood fluke (Schistosoma haematob 98.52
d1z9ha1161 Microsomal prostaglandin E synthase-2 {Crab-eating 97.61
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 97.26
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 96.54
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 96.48
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 96.27
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 96.09
d1abaa_87 Glutaredoxin (Grx, thioltransferase) {Bacteriophag 95.97
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 94.6
d1t1va_93 SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} 90.67
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 87.86
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 84.67
d1g7oa1140 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 82.6
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione S-transferase (GST), N-terminal domain
domain: Yeast prion protein ure2p, nitrogen regulation fragment
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.72  E-value=2.6e-18  Score=133.52  Aligned_cols=82  Identities=17%  Similarity=0.205  Sum_probs=67.0

Q ss_pred             CcEEEEeeCCCchhhHHHHHHHHhCCC-ceeeeeeeCCccccccccccCCCccccCCCCCCCCCCCCCCCCCCcchHHHH
Q 019639           66 GRYHLYISYACPWASRCLAYLKIKGLE-KAISFTSVKPIWEQTKETDEHRGWVFPATNTEEPGAEPDPLNGAKTIRDLYE  144 (338)
Q Consensus        66 gry~LY~~~~cP~a~Rv~i~l~lkGLe-~~i~v~~v~~~~~~~~~~~~~~gW~f~~~~~~~~g~~~d~~~g~~~l~e~Yl  144 (338)
                      ..|+||....||+|+||+++|++|||+ +.+.|++..                                  .++..++|+
T Consensus         4 ~~~tLY~~~~sp~~~kV~~~L~e~gi~ye~~~v~~~~----------------------------------~~~~~~~~~   49 (92)
T d1k0da2           4 EGYTLFSHRSAPNGFKVAIVLSELGFHYNTIFLDFNL----------------------------------GEHRAPEFV   49 (92)
T ss_dssp             SSEEEEECTTCHHHHHHHHHHHHTTCCEEEEECCTTT----------------------------------TGGGSHHHH
T ss_pred             CceEEeeCCCCccHHHHHHHHHHcCCCCEEEEeeccC----------------------------------CcccCHHHH
Confidence            469999999999999999999999998 444443321                                  134568999


Q ss_pred             hhCCCCCCCccccEEEECCCCceecchHHHHHHHHhhccCc
Q 019639          145 LASTNYSGKFTVPVLWDKKLKTIVNNESAEIIRMFNTEFND  185 (338)
Q Consensus       145 ~~nP~y~Gr~tVPvL~D~~~g~ivl~ES~aI~~YL~~~f~~  185 (338)
                      ++||.    ++||||+|..+++++++||.||++||+++|+.
T Consensus        50 ~~np~----g~vP~L~d~~~~~~~l~ES~aI~~YL~~~y~~   86 (92)
T d1k0da2          50 SVNPN----ARVPALIDHGMDNLSIWESGAILLHLVNKYYK   86 (92)
T ss_dssp             TTCTT----CCSCEEEEGGGTTEEEESHHHHHHHHHHHHHH
T ss_pred             HHhhc----cccceeEEecccceEEcCHHHHHHHHHHHhCc
Confidence            99998    58999998544557889999999999999964
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure