Citrus Sinensis ID: 019645

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MVEPSPPSPSLQIPNHMVPPPLDPQPQPSPSPPQPQQQRTSSLFSFPSRPALRVTSEFDSDSSIFLHKISCKLFDSLAKLKVSFQNDNKGQIFEPQLAFTSKHLSLHYDLEEQNAFVKSSFDVGPKLHFRAAHDVKAQQGEVGVVANLGDPGYALELSSPVPYVGYPKATFKFPLGEVSLVEREEEEVKKTLSISGIAKGQILNGICTAQYEEEDLKLRYCYKDEALSFIPTISLPSNALSFALKRQFSPSDKLSYWYNFDSNYWSAVYKHTYGKDFKFKAGYDSEVRLGWASLWVGDEGGKARTAPMKMKVQFMLQVPQDDIKSSALMFRVKKRWDV
cccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccEEEEEEEHHHccccccEEEEEECcccccccccEEEEEEEcEEEEEEccccccEEEECccccccEEEEEEccccccccEEEEEEEccccccEEEEEccccccccccEEEECcccEEEEEEHHHHHHccEEEEEcEEcccccccEEEEEEEccccEEEEEECcccEEEEECccccccccccccccccccccccEEEEEcccccEEEEEECcccccEEEEECccccccEEEEEEEECcccccccccccccEEEEEEEcccccccccEEEEEEEEcccc
*********************************************FPSRPALRVTSEFDSDSSIFLHKISCKLFDSLAKLKVSFQNDNKGQIFEPQLAFTSKHLSLHYDLEEQNAFVKSSFDVGPKLHFRAAHDVKAQQGEVGVVANLGDPGYALELSSPVPYVGYPKATFKFPLGEVS***********TLSISGIAKGQILNGICTAQYEEEDLKLRYCYKDEALSFIPTISLPSNALSFALKRQFSPSDKLSYWYNFDSNYWSAVYKHTYGKDFKFKAGYDSEVRLGWASLWVGDEGGKA**APMKMKVQFMLQVPQDDIKSSALMFRVKKRWD*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVEPSPPSPSLQIPNHMVPPPLDPQPQPSPSPPQPQQQRTSSLFSFPSRPALRVTSEFDSDSSIFLHKISCKLFDSLAKLKVSFQNDNKGQIFEPQLAFTSKHLSLHYDLEEQNAFVKSSFDVGPKLHFRAAHDVKAQQGEVGVVANLGDPGYALELSSPVPYVGYPKATFKFPLGEVSLVEREEEEVKKTLSISGIAKGQILNGICTAQYEEEDLKLRYCYKDEALSFIPTISLPSNALSFALKRQFSPSDKLSYWYNFDSNYWSAVYKHTYGKDFKFKAGYDSEVRLGWASLWVGDEGGKARTAPMKMKVQFMLQVPQDDIKSSALMFRVKKRWDV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Outer envelope pore protein 37, chloroplastic Voltage-dependent peptide-sensitive high conductance rectifying cation channel with a strong affinity for TIC32 that is imported into the chloroplast. Conductance is pH-dependent decreasing with decreasing pH values.probableO80565
Outer envelope pore protein 37, chloroplastic Voltage-dependent peptide-sensitive high conductance rectifying cation channel with a strong affinity for TIC32 that is imported into the chloroplast. Conductance is pH-dependent decreasing with decreasing pH values.probableQ4LDF9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3iot, chain Aprobable Alignment | Template Structure