BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 019667
(337 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1P32|A Chain A, Crystal Structure Of Human P32, A Doughnut-Shaped Acidic
Mitochondrial Matrix Protein
pdb|1P32|B Chain B, Crystal Structure Of Human P32, A Doughnut-Shaped Acidic
Mitochondrial Matrix Protein
pdb|1P32|C Chain C, Crystal Structure Of Human P32, A Doughnut-Shaped Acidic
Mitochondrial Matrix Protein
Length = 209
Score = 28.1 bits (61), Expect = 6.8, Method: Compositional matrix adjust.
Identities = 16/47 (34%), Positives = 23/47 (48%)
Query: 9 TFGGNRKPTPFMCLVMKMLQIQPEKDIVVEFIKNDDYKYVRVLGAFY 55
TF G +P+ + + ++ + VVE IKNDD K VL Y
Sbjct: 69 TFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY 115
>pdb|3RPX|A Chain A, Crystal Structure Of Complement Component 1, Q
Subcomponent Binding Protein, C1qbp
pdb|3RPX|B Chain B, Crystal Structure Of Complement Component 1, Q
Subcomponent Binding Protein, C1qbp
pdb|3RPX|C Chain C, Crystal Structure Of Complement Component 1, Q
Subcomponent Binding Protein, C1qbp
Length = 194
Score = 28.1 bits (61), Expect = 7.0, Method: Compositional matrix adjust.
Identities = 16/47 (34%), Positives = 23/47 (48%)
Query: 9 TFGGNRKPTPFMCLVMKMLQIQPEKDIVVEFIKNDDYKYVRVLGAFY 55
TF G +P+ + + ++ + VVE IKNDD K VL Y
Sbjct: 47 TFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY 93
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.141 0.422
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,001,456
Number of Sequences: 62578
Number of extensions: 246764
Number of successful extensions: 584
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 582
Number of HSP's gapped (non-prelim): 2
length of query: 337
length of database: 14,973,337
effective HSP length: 99
effective length of query: 238
effective length of database: 8,778,115
effective search space: 2089191370
effective search space used: 2089191370
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)