BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 019677
         (337 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2WN6|A Chain A, Structural Basis For Substrate Recognition In The
           Enzymatic Component Of Adp-Ribosyltransferase Toxin Cdta
           From Clostridium Difficile
          Length = 463

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 29/44 (65%), Gaps = 1/44 (2%)

Query: 37  NDAVPAKHTSFLSNFVRASSPTTASHPEKPSQLESIQNKLKKKP 80
           ND +   +T+ ++N++ ++ P    +PE  S++ +I+N LK++P
Sbjct: 294 NDYMRGGYTA-INNYLISNGPVNNPNPELDSKITNIENALKREP 336


>pdb|2WN4|A Chain A, Structural Basis For Substrate Recognition In The
           Enzymatic Component Of Adp-Ribosyltransferase Toxin Cdta
           From Clostridium Difficile
 pdb|2WN5|A Chain A, Structural Basis For Substrate Recognition In The
           Enzymatic Component Of Adp-Ribosyltransferase Toxin Cdta
           From Clostridium Difficile
 pdb|2WN7|A Chain A, Structural Basis For Substrate Recognition In The
           Enzymatic Component Of Adp-Ribosyltransferase Toxin Cdta
           From Clostridium Difficile
 pdb|2WN8|A Chain A, Structural Basis For Substrate Recognition In The
           Enzymatic Component Of Adp-Ribosyltransferase Toxin Cdta
           From Clostridium Difficile
          Length = 463

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 29/44 (65%), Gaps = 1/44 (2%)

Query: 37  NDAVPAKHTSFLSNFVRASSPTTASHPEKPSQLESIQNKLKKKP 80
           ND +   +T+ ++N++ ++ P    +PE  S++ +I+N LK++P
Sbjct: 294 NDYMRGGYTA-INNYLISNGPVNNPNPELDSKITNIENALKREP 336


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.310    0.124    0.340 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,482,884
Number of Sequences: 62578
Number of extensions: 150631
Number of successful extensions: 283
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 279
Number of HSP's gapped (non-prelim): 4
length of query: 337
length of database: 14,973,337
effective HSP length: 99
effective length of query: 238
effective length of database: 8,778,115
effective search space: 2089191370
effective search space used: 2089191370
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 52 (24.6 bits)