Citrus Sinensis ID: 019717

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------
MKMEVERGVQANIGSLSHSNEQVEPEAAVRTCHNGTVSEIPTIDLNDPDQERLTGAIAEASQEWGIFQVINHGIPSELINKLQGVGREFFELPQEEKEAYARPRDAKDIEGYGTRLQKEAEEKKSWVDHIFHRIWPPASRNYRFWPKNPPSYREVNEEYANCMRGVVNKLFRCLSLGLGVEGHALKEAVGGDELEYMLKINYYPPCPRPDLAPGLVPHTDLSSITILVPNDVPGLLAFKGDRSIDVNYIPNALIVTIGDQIEILSNGKYKAVLHKATPHKEKTRISWPVFLDPPADMVVGPLPQLVNGKNPPKYEAKKYKDYVHFKLDELNKKWLLF
cccccccccccccccccccccccccccccccccccccccccEEEcccccHHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHHHHccccHHHHHHHcccccccccCEEcccccccccccEEEEEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccccccEEEEEcccccccccccccccccccccccEEEEEccccccEEEEEccEEEEcccccccEEEEEccEEEEEEcccccccccEECccccccEEEEEEEEccccccCECccccccccccccccccccHHHHHHHHHHccccccccc
*K**********************************VSEIPTIDLNDPDQERLTGAIAEASQEWGIFQVINHGIPSELINKLQGVGREFFELPQEEKEAY**********GYGTRLQKEAEEKKSWVDHIFHRIWPPASRNYRFWPKNPPSYREVNEEYANCMRGVVNKLFRCLSLGLGVEGHALKEAVGGDELEYMLKINYYPPCPRPDLAPGLVPHTDLSSITILVPNDVPGLLAFKGDRSIDVNYIPNALIVTIGDQIEILSNGKYKAVLHKATPHKEKTRISWPVFLDPPADMVVGPLPQLVNGKNPPKYEAKKYKDYVHFKLDELNKKWLLF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKMEVERGVQANIGSLSHSNEQVEPEAAVRTCHNGTVSEIPTIDLNDPDQERLTGAIAEASQEWGIFQVINHGIPSELINKLQGVGREFFELPQEEKEAYARPRDAKDIEGYGTRLQKEAEEKKSWVDHIFHRIWPPASRNYRFWPKNPPSYREVNEEYANCMRGVVNKLFRCLSLGLGVEGHALKEAVGGDELEYMLKINYYPPCPRPDLAPGLVPHTDLSSITILVPNDVPGLLAFKGDRSIDVNYIPNALIVTIGDQIEILSNGKYKAVLHKATPHKEKTRISWPVFLDPPADMVVGPLPQLVNGKNPPKYEAKKYKDYVHFKLDELNKKWLLF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Flavonol synthase/flavanone 3-hydroxylase Catalyzes the formation of flavonols from dihydroflavonols. It can act on dihydrokaempferol to produce kaempferol, on dihydroquercetin to produce quercitin and on dihydromyricetin to produce myricetin. In vitro catalyzes the oxidation of both enantiomers of naringenin to give both cis- and trans-dihydrokaempferol.probableQ96330
Flavonol synthase/flavanone 3-hydroxylase Catalyzes the formation of flavonols from dihydroflavonols. It can act on dihydrokaempferol to produce kaempferol, on dihydroquercetin to produce quercitin and on dihydromyricetin to produce myricetin.probableQ9ZWQ9
Flavonol synthase/flavanone 3-hydroxylase Catalyzes the formation of flavonols from dihydroflavonols. It can act on dihydrokaempferol to produce kaempferol, on dihydroquercetin to produce quercitin and on dihydromyricetin to produce myricetin.probableQ9M547

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.14.-.-Acting on paired donors, with incorporation or reduction of molecular oxygen.probable
1.14.11.-With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.probable
1.14.11.23Flavonol synthase.probable
1.14.11.9Flavanone 3-dioxygenase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OOX, chain A
Confidence level:very confident
Coverage over the Query: 37-330
View the alignment between query and template
View the model in PyMOL
Template: 1GP6, chain A
Confidence level:very confident
Coverage over the Query: 3-334
View the alignment between query and template
View the model in PyMOL