Citrus Sinensis ID: 019740

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330------

MEAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCERMEPRDTKYLSLDDGRKLCLECLDSAIMDTHECQPLYLEIQEFYEGLNMKVEQQVPLLLVERQALNEAMEGEKNGHHHLPETRGLCLSEEQTVTTVLRRPRIGAGYRLIDMITEPYRLIRRCEVTAILILYGLPRLLTGSILAHEMMHAWLRLKGYPNLRPDVEEGICQVLAHMWLESEIYSGSGSDVASSSSSSASSSSSSPSSSSTSSKKGKRSDFEKDLGKFFKHQIESDTSSAYGDGLGKVVRQ

cccccccccccccccccccccccEECcccccccccHHHHHccccccccccccccccccEEEEECccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccEEcHHHHHHHHHcccccccccccccccEEccCEEEEEEECcccccccccEEEEEEccccccccEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHcc

MEAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCERMEPRDTKYLSLDDGRKLCLECLDSAIMDTHECQPLYLEIQEFYEGLNMKVEQQVPLLLVERQAL**************PETRGLCLSEEQTVTTVLRRPRIGAGYRLIDMITEPYRLIRRCEVTAILILYGLPRLLTGSILAHEMMHAWLRLKGYPNLRPDVEEGICQVLAHMWLESEIY*************************************EKDLGKFFKHQIESDTSSAYGDGLGKV***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein DA1-related 1	Ubiquitin receptor that probably regulates developmental process.	probable	Q8W4F0

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RGT, chain A
Confidence level:very confident
Coverage over the Query: 1-67,78-116
View the alignment between query and template
View the model in PyMOL

Template: 1RUT, chain X
Confidence level:very confident
Coverage over the Query: 41-185
View the alignment between query and template
View the model in PyMOL