Citrus Sinensis ID: 019754
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 336 | ||||||
| 356535513 | 337 | PREDICTED: RNA-binding protein Nova-1-li | 0.985 | 0.982 | 0.686 | 1e-126 | |
| 356576359 | 337 | PREDICTED: RNA-binding protein Nova-1-li | 0.985 | 0.982 | 0.674 | 1e-124 | |
| 146336943 | 334 | putative KH-domain containing protein [M | 0.982 | 0.988 | 0.658 | 1e-121 | |
| 224113143 | 334 | predicted protein [Populus trichocarpa] | 0.994 | 1.0 | 0.657 | 1e-120 | |
| 297810533 | 334 | hypothetical protein ARALYDRAFT_487225 [ | 0.994 | 1.0 | 0.619 | 1e-118 | |
| 30680512 | 334 | binding to TOMV RNA 1L (long form) prote | 0.994 | 1.0 | 0.613 | 1e-117 | |
| 359486525 | 309 | PREDICTED: RNA-binding protein Nova-1-li | 0.919 | 1.0 | 0.648 | 1e-116 | |
| 296085941 | 357 | unnamed protein product [Vitis vinifera] | 0.919 | 0.865 | 0.648 | 1e-116 | |
| 255583738 | 314 | Far upstream element-binding protein, pu | 0.931 | 0.996 | 0.635 | 1e-114 | |
| 449449385 | 326 | PREDICTED: RNA-binding protein Nova-2-li | 0.934 | 0.963 | 0.626 | 1e-110 |
| >gi|356535513|ref|XP_003536289.1| PREDICTED: RNA-binding protein Nova-1-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 456 bits (1172), Expect = e-126, Method: Compositional matrix adjust.
Identities = 230/335 (68%), Positives = 276/335 (82%), Gaps = 4/335 (1%)
Query: 1 METNESSYVPSPDVHGKRSTAPV-KSLSSDPTEKPTYIRFLVSNPLAGAVIGKGGSTIND 59
ME+ ESSYV SP+ K + +P KS S D EKPTYIRFLVSN AG+VIGKGGSTI D
Sbjct: 1 MESTESSYVSSPEGPRKHAASPPPKSPSLDSEEKPTYIRFLVSNSAAGSVIGKGGSTITD 60
Query: 60 FQSQSGARIQLSRSHEFFPGTTDRIIMISGTIDEILRAVDLVIDKLLTELHAEDQADDVG 119
FQSQSGARIQLSR+HEFFPGTTDRIIM+SG I+EI RAV+L++ KLL+ELH+ED +D
Sbjct: 61 FQSQSGARIQLSRNHEFFPGTTDRIIMVSGAINEIQRAVELILSKLLSELHSEDD-NDAE 119
Query: 120 TKTKLRLIVPNSSCGSIIGKAGATIKSFMDDSQAVIKISRLDHSYYGLNDRLVTLTGTLD 179
KTK+RL+VPN SCG IIGK GATI+SF++DSQA IKIS D++YYG NDRLVTLTG+ D
Sbjct: 120 PKTKVRLVVPNGSCGGIIGKGGATIRSFIEDSQAGIKISPQDNNYYGQNDRLVTLTGSFD 179
Query: 180 EQMRALELILLKLSEDTLYSQTMTVPYTYAGVFFSGFHGMPYGAVPPPVPAVPHNTAAHY 239
EQMRA+ELI+ KLSED Y+Q+M P++Y GV+FSG+ G+PY V P V A P A +Y
Sbjct: 180 EQMRAIELIVSKLSEDPHYAQSMNSPFSYPGVYFSGYQGVPYTYVLPSV-APPAYNAVNY 238
Query: 240 GPN-MGGRKFQNNKDDRTNSLTIGVADEHIGFVVGRGGRNIMEISQISGARIKVSDRGDF 298
PN G K QN+K++R+NSLT+GVADEHIG VVGRGGRNIMEISQ SGARIK+SDRGD+
Sbjct: 239 RPNGAAGGKLQNSKEERSNSLTMGVADEHIGLVVGRGGRNIMEISQASGARIKISDRGDY 298
Query: 299 FSGTSERKVTISGPQRSIRTAESMIMQKVAYASDR 333
SGT++RKVTI+G QR+IRTAESMI+QKVAYA++R
Sbjct: 299 VSGTTDRKVTITGSQRAIRTAESMILQKVAYATER 333
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356576359|ref|XP_003556300.1| PREDICTED: RNA-binding protein Nova-1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|146336943|gb|ABQ23585.1| putative KH-domain containing protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224113143|ref|XP_002316405.1| predicted protein [Populus trichocarpa] gi|222865445|gb|EEF02576.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297810533|ref|XP_002873150.1| hypothetical protein ARALYDRAFT_487225 [Arabidopsis lyrata subsp. lyrata] gi|297318987|gb|EFH49409.1| hypothetical protein ARALYDRAFT_487225 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|30680512|ref|NP_850764.1| binding to TOMV RNA 1L (long form) protein [Arabidopsis thaliana] gi|332003360|gb|AED90743.1| binding to TOMV RNA 1L (long form) protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|359486525|ref|XP_002264331.2| PREDICTED: RNA-binding protein Nova-1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296085941|emb|CBI31382.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255583738|ref|XP_002532622.1| Far upstream element-binding protein, putative [Ricinus communis] gi|223527642|gb|EEF29753.1| Far upstream element-binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449449385|ref|XP_004142445.1| PREDICTED: RNA-binding protein Nova-2-like [Cucumis sativus] gi|449527683|ref|XP_004170839.1| PREDICTED: RNA-binding protein Nova-2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 336 | ||||||
| TAIR|locus:2184362 | 334 | BTR1L "AT5G04430" [Arabidopsis | 0.994 | 1.0 | 0.607 | 1.9e-106 | |
| RGD|621345 | 474 | Nova1 "neuro-oncological ventr | 0.619 | 0.438 | 0.346 | 6.1e-40 | |
| UNIPROTKB|F1LMZ7 | 474 | Nova1 "RNA-binding protein Nov | 0.619 | 0.438 | 0.346 | 8.1e-40 | |
| UNIPROTKB|D3DS81 | 483 | NOVA1 "Neuro-oncological ventr | 0.619 | 0.430 | 0.342 | 1.7e-39 | |
| ZFIN|ZDB-GENE-060526-113 | 495 | nova1 "neuro-oncological ventr | 0.535 | 0.363 | 0.328 | 3.4e-39 | |
| UNIPROTKB|F1PUD6 | 502 | NOVA2 "Uncharacterized protein | 0.565 | 0.378 | 0.362 | 2.4e-38 | |
| UNIPROTKB|F1MS84 | 464 | NOVA2 "Uncharacterized protein | 0.547 | 0.396 | 0.36 | 4.4e-38 | |
| UNIPROTKB|Q9UNW9 | 492 | NOVA2 "RNA-binding protein Nov | 0.574 | 0.392 | 0.354 | 5.8e-38 | |
| ZFIN|ZDB-GENE-080211-1 | 473 | nova2 "neuro-oncological ventr | 0.550 | 0.391 | 0.336 | 9.8e-38 | |
| UNIPROTKB|F1RM28 | 554 | NOVA2 "Uncharacterized protein | 0.574 | 0.348 | 0.354 | 1.4e-37 |
| TAIR|locus:2184362 BTR1L "AT5G04430" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1053 (375.7 bits), Expect = 1.9e-106, P = 1.9e-106
Identities = 204/336 (60%), Positives = 268/336 (79%)
Query: 1 METNESSYVPSPDVHGKRSTAPVKSLSSDPTEKPTYIRFLVSNPLAGAVIGKGGSTINDF 60
ME+ ES SP+ KRS P S +D EKPT+IRFLVSN AG+VIGKGGSTI +F
Sbjct: 1 MESTESYAAGSPEELAKRSPEPHDSSEADSAEKPTHIRFLVSNAAAGSVIGKGGSTITEF 60
Query: 61 QSQSGARIQLSRSHEFFPGTTDRIIMISGTIDEILRAVDLVIDKLLTELHAEDQADDVGT 120
Q++SGARIQLSR+ EFFPGTTDRIIMISG+I E++ ++L++DKL +ELHAED ++V
Sbjct: 61 QAKSGARIQLSRNQEFFPGTTDRIIMISGSIKEVVNGLELILDKLHSELHAED-GNEVEP 119
Query: 121 KTKLRLIVPNSSCGSIIGKAGATIKSFMDDSQAVIKISRLDHSYYGLNDRLVTLTGTLDE 180
+ ++RL+VPNSSCG IIGK GATIKSF+++S+A IKIS LD+++YGL+DRLVTL+GT +E
Sbjct: 120 RRRIRLVVPNSSCGGIIGKGGATIKSFIEESKAGIKISPLDNTFYGLSDRLVTLSGTFEE 179
Query: 181 QMRALELILLKLSEDTLYSQTMTVPYTYAGVFFSGFHGMPYGXXXXXXXXXXHNTAAHYG 240
QMRA++LIL KL+ED YSQ + PY+YAG+F+SGFHG PY +N+ +Y
Sbjct: 180 QMRAIDLILAKLTEDDHYSQNVHSPYSYAGLFYSGFHGPPYAYALPSVATAGYNSV-NYA 238
Query: 241 PNMGGRKFQNNKDDRTNSLTIGVADEHIGFVVGRGGRNIMEISQISGARIKVSDRGDFFS 300
PN G K+QN+K++ + ++TIGVADEHIG V+GRGGRNIMEI+Q++GARIK+SDRGDF S
Sbjct: 239 PNGSGGKYQNHKEEASTTVTIGVADEHIGLVLGRGGRNIMEITQMTGARIKISDRGDFMS 298
Query: 301 GTSERKVTISGPQRSIRTAESMIMQKVAYASDRLMD 336
GT++RKV+I+GPQR+I+ AE+MI QKV A++R D
Sbjct: 299 GTTDRKVSITGPQRAIQQAETMIKQKVDSATERTTD 334
|
|
| RGD|621345 Nova1 "neuro-oncological ventral antigen 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LMZ7 Nova1 "RNA-binding protein Nova-1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D3DS81 NOVA1 "Neuro-oncological ventral antigen 1, isoform CRA_a" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060526-113 nova1 "neuro-oncological ventral antigen 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PUD6 NOVA2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MS84 NOVA2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UNW9 NOVA2 "RNA-binding protein Nova-2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-080211-1 nova2 "neuro-oncological ventral antigen 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RM28 NOVA2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pg.C_LG_X2076 | hypothetical protein (335 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 336 | |||
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 4e-19 | |
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 2e-17 | |
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 3e-13 | |
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 4e-13 | |
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 1e-12 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 4e-11 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 3e-10 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 4e-10 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 1e-09 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 1e-09 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 2e-09 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 3e-09 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 1e-08 | |
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 4e-08 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 8e-07 | |
| cd02394 | 62 | cd02394, vigilin_like_KH, K homology RNA-binding d | 5e-06 | |
| cd02394 | 62 | cd02394, vigilin_like_KH, K homology RNA-binding d | 3e-04 | |
| cd02394 | 62 | cd02394, vigilin_like_KH, K homology RNA-binding d | 5e-04 | |
| TIGR03591 | 684 | TIGR03591, polynuc_phos, polyribonucleotide nucleo | 0.001 | |
| cd02393 | 61 | cd02393, PNPase_KH, Polynucleotide phosphorylase ( | 0.003 |
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
Score = 79.4 bits (197), Expect = 4e-19
Identities = 27/66 (40%), Positives = 48/66 (72%), Gaps = 2/66 (3%)
Query: 37 IRFLVSNPLAGAVIGKGGSTINDFQSQSGARIQLSRSHEFFPGTTDRIIMISGTIDEILR 96
+R LV + AG++IGKGGSTI + + ++GA+I++S+S PG+T+R++ ISG + +
Sbjct: 2 LRLLVPSSQAGSIIGKGGSTIKEIREETGAKIRVSKSVL--PGSTERVVTISGKPSAVQK 59
Query: 97 AVDLVI 102
A+ L++
Sbjct: 60 ALLLIL 65
|
Members of this group possess KH domains in a tandem arrangement. Most members, similar to the poly(C) binding proteins (PCBPs) and Nova, containing three KH domains, with the first and second domains, which are represented here, in tandem arrangement, followed by a large spacer region, with the third domain near the C-terminal end of the protein. The poly(C) binding proteins (PCBPs) can be divided into two groups, hnRNPs K/J and the alphaCPs, which share a triple KH domain configuration and poly(C) binding specificity. They play roles in mRNA stabilization, translational activation, and translational silencing. Nova-1 and Nova-2 are nuclear RNA-binding proteins that regulate splicing. This group also contains plant proteins that seem to have two tandem repeat arrrangements, like Hen4, a protein that plays a role in AGAMOUS (AG) pre-mRNA processing and important step in plant development. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. Length = 65 |
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|239086 cd02393, PNPase_KH, Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 336 | |||
| KOG2192 | 390 | consensus PolyC-binding hnRNP-K protein HRB57A/hnR | 100.0 | |
| KOG1676 | 600 | consensus K-homology type RNA binding proteins [RN | 100.0 | |
| KOG2191 | 402 | consensus RNA-binding protein NOVA1/PASILLA and re | 100.0 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 100.0 | |
| KOG1676 | 600 | consensus K-homology type RNA binding proteins [RN | 100.0 | |
| KOG2190 | 485 | consensus PolyC-binding proteins alphaCP-1 and rel | 100.0 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 99.97 | |
| KOG2191 | 402 | consensus RNA-binding protein NOVA1/PASILLA and re | 99.93 | |
| KOG2190 | 485 | consensus PolyC-binding proteins alphaCP-1 and rel | 99.8 | |
| KOG2192 | 390 | consensus PolyC-binding hnRNP-K protein HRB57A/hnR | 99.78 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 99.72 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 99.7 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 99.7 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 99.67 | |
| cd02396 | 65 | PCBP_like_KH K homology RNA-binding domain, PCBP_l | 99.52 | |
| cd02396 | 65 | PCBP_like_KH K homology RNA-binding domain, PCBP_l | 99.52 | |
| KOG2279 | 608 | consensus Kinase anchor protein AKAP149, contains | 99.51 | |
| cd02394 | 62 | vigilin_like_KH K homology RNA-binding domain_vigi | 99.4 | |
| PF00013 | 60 | KH_1: KH domain syndrome, contains KH motifs.; Int | 99.39 | |
| cd02393 | 61 | PNPase_KH Polynucleotide phosphorylase (PNPase) K | 99.35 | |
| PF00013 | 60 | KH_1: KH domain syndrome, contains KH motifs.; Int | 99.34 | |
| cd00105 | 64 | KH-I K homology RNA-binding domain, type I. KH bin | 99.32 | |
| cd02394 | 62 | vigilin_like_KH K homology RNA-binding domain_vigi | 99.31 | |
| cd00105 | 64 | KH-I K homology RNA-binding domain, type I. KH bin | 99.26 | |
| cd02393 | 61 | PNPase_KH Polynucleotide phosphorylase (PNPase) K | 99.24 | |
| KOG2208 | 753 | consensus Vigilin [Lipid transport and metabolism] | 99.16 | |
| PF13014 | 43 | KH_3: KH domain | 99.09 | |
| PF13014 | 43 | KH_3: KH domain | 99.08 | |
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 99.05 | |
| smart00322 | 69 | KH K homology RNA-binding domain. | 99.05 | |
| KOG2208 | 753 | consensus Vigilin [Lipid transport and metabolism] | 99.04 | |
| smart00322 | 69 | KH K homology RNA-binding domain. | 99.0 | |
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 98.96 | |
| KOG2279 | 608 | consensus Kinase anchor protein AKAP149, contains | 98.72 | |
| cd02395 | 120 | SF1_like-KH Splicing factor 1 (SF1) K homology RNA | 98.59 | |
| KOG2113 | 394 | consensus Predicted RNA binding protein, contains | 98.58 | |
| cd02395 | 120 | SF1_like-KH Splicing factor 1 (SF1) K homology RNA | 98.56 | |
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 98.38 | |
| KOG2113 | 394 | consensus Predicted RNA binding protein, contains | 98.38 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 98.12 | |
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 98.11 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 98.1 | |
| TIGR01952 | 141 | nusA_arch NusA family KH domain protein, archaeal. | 97.82 | |
| KOG0119 | 554 | consensus Splicing factor 1/branch point binding p | 97.81 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 97.74 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 97.7 | |
| KOG0119 | 554 | consensus Splicing factor 1/branch point binding p | 97.66 | |
| PF14611 | 210 | SLS: Mitochondrial inner-membrane-bound regulator | 97.63 | |
| TIGR01952 | 141 | nusA_arch NusA family KH domain protein, archaeal. | 97.49 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 97.45 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 97.31 | |
| KOG2814 | 345 | consensus Transcription coactivator complex, P50 c | 97.29 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 97.29 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 97.28 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 97.28 | |
| KOG1588 | 259 | consensus RNA-binding protein Sam68 and related KH | 97.24 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 97.23 | |
| COG0195 | 190 | NusA Transcription elongation factor [Transcriptio | 97.22 | |
| cd02134 | 61 | NusA_KH NusA_K homology RNA-binding domain (KH). N | 97.2 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 97.18 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 97.17 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 97.08 | |
| KOG2814 | 345 | consensus Transcription coactivator complex, P50 c | 97.05 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 96.99 | |
| KOG1588 | 259 | consensus RNA-binding protein Sam68 and related KH | 96.96 | |
| cd02134 | 61 | NusA_KH NusA_K homology RNA-binding domain (KH). N | 96.94 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 96.92 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 96.91 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 96.84 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 96.8 | |
| PRK00468 | 75 | hypothetical protein; Provisional | 96.61 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 96.61 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 96.57 | |
| COG0195 | 190 | NusA Transcription elongation factor [Transcriptio | 96.57 | |
| COG5176 | 269 | MSL5 Splicing factor (branch point binding protein | 96.55 | |
| PF14611 | 210 | SLS: Mitochondrial inner-membrane-bound regulator | 96.54 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 96.54 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 96.49 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 96.49 | |
| PRK02821 | 77 | hypothetical protein; Provisional | 96.43 | |
| PRK12705 | 508 | hypothetical protein; Provisional | 96.36 | |
| COG1837 | 76 | Predicted RNA-binding protein (contains KH domain) | 96.21 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 96.16 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 96.12 | |
| PRK01064 | 78 | hypothetical protein; Provisional | 96.08 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 96.02 | |
| COG5176 | 269 | MSL5 Splicing factor (branch point binding protein | 95.93 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 95.86 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 95.76 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 95.64 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 95.63 | |
| PRK00468 | 75 | hypothetical protein; Provisional | 95.53 | |
| PRK12705 | 508 | hypothetical protein; Provisional | 95.52 | |
| PRK02821 | 77 | hypothetical protein; Provisional | 95.35 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 95.32 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 94.98 | |
| COG1837 | 76 | Predicted RNA-binding protein (contains KH domain) | 94.65 | |
| PRK01064 | 78 | hypothetical protein; Provisional | 94.42 | |
| PF13083 | 73 | KH_4: KH domain; PDB: 3GKU_B. | 94.41 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 93.9 | |
| KOG2874 | 356 | consensus rRNA processing protein [Translation, ri | 93.79 | |
| cd02409 | 68 | KH-II KH-II (K homology RNA-binding domain, type I | 93.38 | |
| KOG3273 | 252 | consensus Predicted RNA-binding protein Pno1p inte | 93.05 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 92.98 | |
| PF13083 | 73 | KH_4: KH domain; PDB: 3GKU_B. | 92.95 | |
| PF13184 | 69 | KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW | 92.86 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 92.81 | |
| PF13184 | 69 | KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW | 92.57 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 92.52 | |
| KOG3273 | 252 | consensus Predicted RNA-binding protein Pno1p inte | 92.3 | |
| cd02410 | 145 | archeal_CPSF_KH The archaeal cleavage and polyaden | 92.03 | |
| cd02414 | 77 | jag_KH jag_K homology RNA-binding domain. The KH d | 91.97 | |
| cd02409 | 68 | KH-II KH-II (K homology RNA-binding domain, type I | 91.79 | |
| PF07650 | 78 | KH_2: KH domain syndrome, contains KH motifs.; Int | 91.52 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 90.69 | |
| KOG2874 | 356 | consensus rRNA processing protein [Translation, ri | 90.28 | |
| COG5166 | 657 | Uncharacterized conserved protein [Function unknow | 90.21 | |
| cd02413 | 81 | 40S_S3_KH K homology RNA-binding (KH) domain of th | 90.2 | |
| cd02414 | 77 | jag_KH jag_K homology RNA-binding domain. The KH d | 89.81 | |
| PRK06418 | 166 | transcription elongation factor NusA-like protein; | 89.12 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 88.95 | |
| PF07650 | 78 | KH_2: KH domain syndrome, contains KH motifs.; Int | 88.39 | |
| COG1782 | 637 | Predicted metal-dependent RNase, consists of a met | 87.85 | |
| PRK13764 | 602 | ATPase; Provisional | 87.31 | |
| PRK13764 | 602 | ATPase; Provisional | 87.11 | |
| COG5166 | 657 | Uncharacterized conserved protein [Function unknow | 86.64 | |
| cd02412 | 109 | 30S_S3_KH K homology RNA-binding (KH) domain of th | 85.89 | |
| cd02411 | 85 | archeal_30S_S3_KH K homology RNA-binding domain (K | 85.13 | |
| cd02410 | 145 | archeal_CPSF_KH The archaeal cleavage and polyaden | 82.57 | |
| PRK06418 | 166 | transcription elongation factor NusA-like protein; | 82.39 | |
| COG0092 | 233 | RpsC Ribosomal protein S3 [Translation, ribosomal | 82.16 | |
| cd02413 | 81 | 40S_S3_KH K homology RNA-binding (KH) domain of th | 81.39 |
| >KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.9e-40 Score=278.86 Aligned_cols=285 Identities=27% Similarity=0.439 Sum_probs=224.6
Q ss_pred CCCcEEEEEEEecCccceeecCCChHHHHHHHHhCCeEEEcCCCCCCCCCCceEEEEEeeHHHHHHHHHHHHHHHHhhcc
Q 019754 31 TEKPTYIRFLVSNPLAGAVIGKGGSTINDFQSQSGARIQLSRSHEFFPGTTDRIIMISGTIDEILRAVDLVIDKLLTELH 110 (336)
Q Consensus 31 ~~~~~~~~i~ip~~~vg~iIGk~G~~Ik~I~~~tg~~I~i~~~~~~~~~~~~r~i~I~G~~~~v~~A~~~I~~~i~~~~~ 110 (336)
....+.++||+.+..+|+||||+|++||.|+.+++++|+|++++ .++|+|+|+.+.+.|...++.|+-.|.+.+
T Consensus 44 k~~r~e~ril~~sk~agavigkgg~nik~lr~d~na~v~vpds~-----~peri~tisad~~ti~~ilk~iip~lee~f- 117 (390)
T KOG2192|consen 44 KRSRVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSS-----GPERILTISADIETIGEILKKIIPTLEEGF- 117 (390)
T ss_pred hhcceeEEEEEecccccceeccccccHHHHhhhccceeeccCCC-----CCceeEEEeccHHHHHHHHHHHhhhhhhCC-
Confidence 44579999999999999999999999999999999999999876 579999999999999888887776655543
Q ss_pred ccccCCCCCCceeEEEEEecCccceeecCCChHHHHHHHhcCCEEEEeccCCCCCCCCceEEEEEcCHHHHHHHHHHHHH
Q 019754 111 AEDQADDVGTKTKLRLIVPNSSCGSIIGKAGATIKSFMDDSQAVIKISRLDHSYYGLNDRLVTLTGTLDEQMRALELILL 190 (336)
Q Consensus 111 ~~~~~~~~~~~~~~~l~ip~~~~g~iIG~~G~~Ik~I~~~tga~I~i~~~~~~~~~~~~r~v~I~G~~~~v~~A~~~i~~ 190 (336)
...+.+.++|+|..+.+|.|||++|++||+|++++.++++|.. +.|+++++|+|.+.|.+.+|..+++.|++
T Consensus 118 ------~~~~pce~rllihqs~ag~iigrngskikelrekcsarlkift--~c~p~stdrv~l~~g~~k~v~~~i~~il~ 189 (390)
T KOG2192|consen 118 ------QLPSPCELRLLIHQSLAGGIIGRNGSKIKELREKCSARLKIFT--ECCPHSTDRVVLIGGKPKRVVECIKIILD 189 (390)
T ss_pred ------CCCCchhhhhhhhhhhccceecccchhHHHHHHhhhhhhhhhh--ccCCCCcceEEEecCCcchHHHHHHHHHH
Confidence 2346799999999999999999999999999999999999987 78999999999999999999999999999
Q ss_pred HhhcCcC------CCCCc-CCCccCCCccccCC--CCCCCCCCCCC----CCCCCCCC----------------------
Q 019754 191 KLSEDTL------YSQTM-TVPYTYAGVFFSGF--HGMPYGAVPPP----VPAVPHNT---------------------- 235 (336)
Q Consensus 191 ~l~~~~~------~~~~~-~~~~~~~g~~~~~~--~~~p~~~~~~~----~~~~~~~~---------------------- 235 (336)
++.+.+. |.+.. ...+.|+|..+... .+.|. +.|++ +++++...
T Consensus 190 ~i~e~pikgsa~py~p~fyd~t~dyggf~M~f~d~pg~pg-papqrggqgpp~~~~sdlmay~r~GrpG~rydg~vdFs~ 268 (390)
T KOG2192|consen 190 LISESPIKGSAQPYDPNFYDETYDYGGFTMMFDDRPGRPG-PAPQRGGQGPPPPRGSDLMAYDRRGRPGDRYDGMVDFSA 268 (390)
T ss_pred HhhcCCcCCcCCcCCccccCcccccCCceeecCCCCCCCC-CCCCCCCCCCCCCCccccceeccCCCCCccccccccccc
Confidence 9988654 33332 23355666544322 11111 11111 11111101
Q ss_pred ----------------CCCCCCCCCCCCccCCC---------CCCceEEEEEeccCcccceeccCCchHHHHHhHhCCeE
Q 019754 236 ----------------AAHYGPNMGGRKFQNNK---------DDRTNSLTIGVADEHIGFVVGRGGRNIMEISQISGARI 290 (336)
Q Consensus 236 ----------------~~~~~~~g~~~~~~~~~---------~~~~~~~~v~vp~~~vg~IIGk~G~~I~~I~~~sga~I 290 (336)
.|.|.+.++.....+++ ..+..+.+|.||+++-|.||||+|+.|++|++++||.|
T Consensus 269 detw~saidtw~~SewqmaYePQgGs~ydysyAG~~GsYGdlGGPitTaQvtip~dlggsiigkggqri~~ir~esGA~I 348 (390)
T KOG2192|consen 269 DETWPSAIDTWSPSEWQMAYEPQGGSGYDYSYAGGYGSYGDLGGPITTAQVTIPKDLGGSIIGKGGQRIKQIRHESGASI 348 (390)
T ss_pred cccCCCcCCCcCccccccccCCCCCCCCCccccccccccCCCCCceeeeeEecccccCcceecccchhhhhhhhccCceE
Confidence 12333332222111111 35678899999999999999999999999999999999
Q ss_pred EEccCCCCCCCCcceEEEEEcChHhHHHHHHHHHHHHHhhhhc
Q 019754 291 KVSDRGDFFSGTSERKVTISGPQRSIRTAESMIMQKVAYASDR 333 (336)
Q Consensus 291 ~i~~~~~~~~~~~~r~v~I~G~~~~v~~A~~~I~~~i~~~~~~ 333 (336)
+|.. |..++.+|+++|+||.+|++.|+.|++..++.+.+|
T Consensus 349 kide---pleGsedrIitItGTqdQIqnAQYLlQn~Vkq~rer 388 (390)
T KOG2192|consen 349 KIDE---PLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYRER 388 (390)
T ss_pred EecC---cCCCCCceEEEEeccHHHHhhHHHHHHHHHHhhhcc
Confidence 9987 577899999999999999999999999999987765
|
|
| >KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >PF00013 KH_1: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PF00013 KH_1: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >cd00105 KH-I K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >cd00105 KH-I K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG2208 consensus Vigilin [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13014 KH_3: KH domain | Back alignment and domain information |
|---|
| >PF13014 KH_3: KH domain | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >smart00322 KH K homology RNA-binding domain | Back alignment and domain information |
|---|
| >KOG2208 consensus Vigilin [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >smart00322 KH K homology RNA-binding domain | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >TIGR01952 nusA_arch NusA family KH domain protein, archaeal | Back alignment and domain information |
|---|
| >KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF14611 SLS: Mitochondrial inner-membrane-bound regulator | Back alignment and domain information |
|---|
| >TIGR01952 nusA_arch NusA family KH domain protein, archaeal | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >COG0195 NusA Transcription elongation factor [Transcription] | Back alignment and domain information |
|---|
| >cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PRK00468 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >COG0195 NusA Transcription elongation factor [Transcription] | Back alignment and domain information |
|---|
| >COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF14611 SLS: Mitochondrial inner-membrane-bound regulator | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK02821 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK01064 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >PRK00468 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02821 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01064 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13083 KH_4: KH domain; PDB: 3GKU_B | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2874 consensus rRNA processing protein [Translation, ribosomal structure and biogenesis; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd02409 KH-II KH-II (K homology RNA-binding domain, type II) | Back alignment and domain information |
|---|
| >KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13083 KH_4: KH domain; PDB: 3GKU_B | Back alignment and domain information |
|---|
| >PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >cd02414 jag_KH jag_K homology RNA-binding domain | Back alignment and domain information |
|---|
| >cd02409 KH-II KH-II (K homology RNA-binding domain, type II) | Back alignment and domain information |
|---|
| >PF07650 KH_2: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2874 consensus rRNA processing protein [Translation, ribosomal structure and biogenesis; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5166 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3 | Back alignment and domain information |
|---|
| >cd02414 jag_KH jag_K homology RNA-binding domain | Back alignment and domain information |
|---|
| >PRK06418 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >PF07650 KH_2: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >COG5166 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd02412 30S_S3_KH K homology RNA-binding (KH) domain of the prokaryotic 30S small ribosomal subunit protein S3 | Back alignment and domain information |
|---|
| >cd02411 archeal_30S_S3_KH K homology RNA-binding domain (KH) of the archaeal 30S small ribosomal subunit S3 protein | Back alignment and domain information |
|---|
| >cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PRK06418 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >COG0092 RpsC Ribosomal protein S3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 336 | ||||
| 2ann_A | 178 | Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDE | 4e-26 | ||
| 2ann_A | 178 | Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDE | 4e-11 | ||
| 2anr_A | 178 | Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TAND | 4e-25 | ||
| 2anr_A | 178 | Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TAND | 1e-10 | ||
| 2jzx_A | 160 | Pcbp2 Kh1-Kh2 Domains Length = 160 | 5e-14 | ||
| 2jzx_A | 160 | Pcbp2 Kh1-Kh2 Domains Length = 160 | 2e-09 | ||
| 1ec6_A | 87 | Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Bind | 2e-10 | ||
| 1dtj_A | 76 | Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Bind | 4e-10 | ||
| 1dt4_A | 73 | Crystal Structure Of Nova-1 Kh3 K-Homology Rna-Bind | 2e-09 | ||
| 1j4w_A | 174 | Complex Of The Kh3 And Kh4 Domains Of Fbp With A Si | 3e-08 | ||
| 1wvn_A | 82 | Crsytal Structure Of Domain 3 Of Human Alpha Polyc | 5e-06 | ||
| 3vke_A | 76 | Contribution Of The First K-Homology Domain Of Poly | 1e-05 | ||
| 3vke_A | 76 | Contribution Of The First K-Homology Domain Of Poly | 8e-05 | ||
| 1ztg_A | 74 | Human Alpha Polyc Binding Protein Kh1 Length = 74 | 2e-05 | ||
| 1ztg_A | 74 | Human Alpha Polyc Binding Protein Kh1 Length = 74 | 1e-04 | ||
| 2p2r_A | 76 | Crystal Structure Of The Third Kh Domain Of Human P | 2e-05 | ||
| 1j5k_A | 89 | Complex Of The Kh3 Domain Of Hnrnp K With A Single_ | 6e-05 | ||
| 1j5k_A | 89 | Complex Of The Kh3 Domain Of Hnrnp K With A Single_ | 9e-05 | ||
| 1zzi_A | 82 | Crystal Structure Analysis Of The Third Kh Domain O | 6e-05 | ||
| 1zzi_A | 82 | Crystal Structure Analysis Of The Third Kh Domain O | 8e-05 | ||
| 1we8_A | 104 | Solution Structure Of Kh Domain In Protein Bab28342 | 8e-05 | ||
| 2axy_A | 73 | Crystal Structure Of Kh1 Domain Of Human Poly(C)-Bi | 1e-04 | ||
| 2opu_A | 89 | Solution Nmr Structure Of The First Domain Of Ksrp | 3e-04 | ||
| 2jvz_A | 164 | Solution Nmr Structure Of The Second And Third Kh D | 3e-04 | ||
| 3krm_A | 163 | Imp1 Kh34 Length = 163 | 4e-04 | ||
| 1khm_A | 89 | C-Terminal Kh Domain Of Hnrnp K (Kh3) Length = 89 | 5e-04 | ||
| 1khm_A | 89 | C-Terminal Kh Domain Of Hnrnp K (Kh3) Length = 89 | 7e-04 | ||
| 1x4n_A | 92 | Solution Structure Of Kh Domain In Fuse Binding Pro | 6e-04 |
| >pdb|2ANN|A Chain A, Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25 NT RNA Hairpin Length = 178 | Back alignment and structure |
|
| >pdb|2ANN|A Chain A, Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25 NT RNA Hairpin Length = 178 | Back alignment and structure |
| >pdb|2ANR|A Chain A, Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25NT RNA Hairpin Length = 178 | Back alignment and structure |
| >pdb|2ANR|A Chain A, Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25NT RNA Hairpin Length = 178 | Back alignment and structure |
| >pdb|2JZX|A Chain A, Pcbp2 Kh1-Kh2 Domains Length = 160 | Back alignment and structure |
| >pdb|2JZX|A Chain A, Pcbp2 Kh1-Kh2 Domains Length = 160 | Back alignment and structure |
| >pdb|1EC6|A Chain A, Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Binding Domain Bound To 20-Mer Rna Hairpin Length = 87 | Back alignment and structure |
| >pdb|1DTJ|A Chain A, Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Binding Domain Length = 76 | Back alignment and structure |
| >pdb|1DT4|A Chain A, Crystal Structure Of Nova-1 Kh3 K-Homology Rna-Binding Domain Length = 73 | Back alignment and structure |
| >pdb|1J4W|A Chain A, Complex Of The Kh3 And Kh4 Domains Of Fbp With A Single_stranded 29mer Dna Oligonucleotide From The Fuse Element Of The C-Myc Oncogene Length = 174 | Back alignment and structure |
| >pdb|1WVN|A Chain A, Crsytal Structure Of Domain 3 Of Human Alpha Polyc Binding Protein Length = 82 | Back alignment and structure |
| >pdb|3VKE|A Chain A, Contribution Of The First K-Homology Domain Of Poly(C)-Binding Protein 1 To Its Affinity And Specificity For C-Rich Oligonucleotides Length = 76 | Back alignment and structure |
| >pdb|3VKE|A Chain A, Contribution Of The First K-Homology Domain Of Poly(C)-Binding Protein 1 To Its Affinity And Specificity For C-Rich Oligonucleotides Length = 76 | Back alignment and structure |
| >pdb|1ZTG|A Chain A, Human Alpha Polyc Binding Protein Kh1 Length = 74 | Back alignment and structure |
| >pdb|1ZTG|A Chain A, Human Alpha Polyc Binding Protein Kh1 Length = 74 | Back alignment and structure |
| >pdb|2P2R|A Chain A, Crystal Structure Of The Third Kh Domain Of Human Poly(C)- Binding Protein-2 In Complex With C-Rich Strand Of Human Telomeric Dna Length = 76 | Back alignment and structure |
| >pdb|1J5K|A Chain A, Complex Of The Kh3 Domain Of Hnrnp K With A Single_stranded 10mer Dna Oligonucleotide Length = 89 | Back alignment and structure |
| >pdb|1J5K|A Chain A, Complex Of The Kh3 Domain Of Hnrnp K With A Single_stranded 10mer Dna Oligonucleotide Length = 89 | Back alignment and structure |
| >pdb|1ZZI|A Chain A, Crystal Structure Analysis Of The Third Kh Domain Of Hnrnp K In Complex With Ssdna Length = 82 | Back alignment and structure |
| >pdb|1ZZI|A Chain A, Crystal Structure Analysis Of The Third Kh Domain Of Hnrnp K In Complex With Ssdna Length = 82 | Back alignment and structure |
| >pdb|1WE8|A Chain A, Solution Structure Of Kh Domain In Protein Bab28342 Length = 104 | Back alignment and structure |
| >pdb|2AXY|A Chain A, Crystal Structure Of Kh1 Domain Of Human Poly(C)-Binding Protein-2 With C-Rich Strand Of Human Telomeric Dna Length = 73 | Back alignment and structure |
| >pdb|2OPU|A Chain A, Solution Nmr Structure Of The First Domain Of Ksrp Length = 89 | Back alignment and structure |
| >pdb|2JVZ|A Chain A, Solution Nmr Structure Of The Second And Third Kh Domains Of Ksrp Length = 164 | Back alignment and structure |
| >pdb|3KRM|A Chain A, Imp1 Kh34 Length = 163 | Back alignment and structure |
| >pdb|1KHM|A Chain A, C-Terminal Kh Domain Of Hnrnp K (Kh3) Length = 89 | Back alignment and structure |
| >pdb|1KHM|A Chain A, C-Terminal Kh Domain Of Hnrnp K (Kh3) Length = 89 | Back alignment and structure |
| >pdb|1X4N|A Chain A, Solution Structure Of Kh Domain In Fuse Binding Protein 1 Length = 92 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 336 | |||
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 1e-47 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 5e-33 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 2e-18 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 1e-14 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 3e-42 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 3e-30 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 2e-15 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 3e-41 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 2e-27 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 9e-18 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 3e-12 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 5e-40 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 1e-29 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 9e-16 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 3e-12 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 6e-40 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 3e-37 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 2e-17 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 1e-23 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 1e-21 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 2e-18 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 2e-23 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 7e-21 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 3e-18 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 1e-20 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 8e-17 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 1e-14 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 4e-20 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 4e-17 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 2e-15 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 7e-20 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 2e-17 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 2e-15 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 9e-20 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 3e-17 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 7e-16 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 1e-19 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 1e-17 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 1e-15 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 9e-19 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 1e-18 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 1e-17 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 2e-18 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 3e-15 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 1e-13 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 7e-18 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 1e-17 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 1e-16 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 5e-17 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 4e-14 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 3e-13 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 6e-17 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 2e-15 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 2e-15 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 8e-17 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 1e-16 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 5e-15 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 8e-13 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 3e-09 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 5e-08 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 7e-12 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 7e-07 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 4e-04 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 1e-11 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-09 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-08 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 1e-10 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 1e-06 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 3e-10 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-09 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 1e-06 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 7e-10 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 3e-08 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 3e-06 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 4e-09 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 6e-08 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 6e-07 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 3e-08 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 1e-05 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 1e-05 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 9e-08 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 4e-05 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 5e-06 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 2e-05 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 9e-04 |
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
Score = 157 bits (399), Expect = 1e-47
Identities = 60/177 (33%), Positives = 105/177 (59%), Gaps = 12/177 (6%)
Query: 30 PTEKPTYIRFLVSNPLAGAVIGKGGSTINDFQSQSGARIQLSRSHEFFPGTTDRIIMISG 89
P +++ L+ + AG++IGKGG TI Q ++GA I+LS+S +F+PGTT+R+ +I G
Sbjct: 1 PLGSQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQG 60
Query: 90 TIDEILRAVDLVIDKLLTELHAEDQADDV-----------GTKTKLRLIVPNSSCGSIIG 138
TI+ + + +K+ + + V ++++IVPNS+ G IIG
Sbjct: 61 TIEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRANQVKIIVPNSTAGLIIG 120
Query: 139 KAGATIKSFMDDSQAVIKISRLDHSYYGLNDRLVTLTGTLDEQMRALELILLKLSED 195
K GAT+K+ M+ S A +++S+ L +R+VT++G ++ +A+ELI+ K+ ED
Sbjct: 121 KGGATVKAIMEQSGAWVQLSQ-KPDGINLQNRVVTVSGEPEQNRKAVELIIQKIQED 176
|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 336 | |||
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 99.95 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 99.95 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 99.95 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 99.95 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 99.94 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 99.94 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 99.94 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 99.94 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 99.94 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 99.94 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 99.94 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 99.82 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 99.8 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 99.75 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 99.72 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 99.68 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 99.65 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 99.64 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 99.63 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 99.63 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 99.63 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 99.63 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 99.63 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 99.62 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 99.62 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 99.61 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 99.61 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 99.58 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 99.58 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 99.58 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 99.57 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 99.56 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 99.56 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 99.56 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 99.55 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 99.54 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 99.54 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 99.54 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 99.53 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.51 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 99.5 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 99.49 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 99.49 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 99.49 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 99.49 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 99.49 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 99.47 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 99.46 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 99.46 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 99.43 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 99.42 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 99.42 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 99.41 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 99.41 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.4 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 99.4 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.31 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 99.3 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.26 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 99.23 | |
| 2cpq_A | 91 | FragIle X mental retardation syndrome related prot | 99.03 | |
| 2yqr_A | 119 | KIAA0907 protein; structure genomics, KH domain, s | 98.81 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 98.77 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 98.69 | |
| 2cpq_A | 91 | FragIle X mental retardation syndrome related prot | 98.68 | |
| 2yqr_A | 119 | KIAA0907 protein; structure genomics, KH domain, s | 98.66 | |
| 2bl5_A | 140 | MGC83862 protein, quaking protein; STAR proteins, | 98.32 | |
| 2bl5_A | 140 | MGC83862 protein, quaking protein; STAR proteins, | 98.29 | |
| 3v69_A | 140 | Protein filia; RNA-binding, embryogenesis, KH doma | 98.28 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 98.13 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 98.1 | |
| 2cxc_A | 144 | NUSA; transcription termination, RNA binding prote | 97.8 | |
| 3v69_A | 140 | Protein filia; RNA-binding, embryogenesis, KH doma | 97.66 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 97.58 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 97.55 | |
| 2cxc_A | 144 | NUSA; transcription termination, RNA binding prote | 97.43 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 96.49 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 96.22 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 96.06 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 95.83 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 95.79 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 95.68 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 95.19 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 95.0 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 94.74 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 93.85 | |
| 4hhu_A | 170 | OR280; engineered protein, PSI-biology, structural | 92.11 | |
| 2pt7_G | 152 | HP1451, hypothetical protein; ATPase, protein-prot | 83.45 | |
| 1wh9_A | 92 | 40S ribosomal protein S3; KH domain, structural ge | 81.24 |
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
Probab=99.95 E-value=2.9e-28 Score=205.38 Aligned_cols=165 Identities=35% Similarity=0.626 Sum_probs=138.5
Q ss_pred CCCcEEEEEEEecCccceeecCCChHHHHHHHHhCCeEEEcCCCCCCCCCCceEEEEEeeHHHHHHHHHHHHHHHHhhcc
Q 019754 31 TEKPTYIRFLVSNPLAGAVIGKGGSTINDFQSQSGARIQLSRSHEFFPGTTDRIIMISGTIDEILRAVDLVIDKLLTELH 110 (336)
Q Consensus 31 ~~~~~~~~i~ip~~~vg~iIGk~G~~Ik~I~~~tg~~I~i~~~~~~~~~~~~r~i~I~G~~~~v~~A~~~I~~~i~~~~~ 110 (336)
.+++++++|+||.+++|.||||+|++|++|+++|||+|+|++..+..+++.+|+|.|+|+.+++.+|+.+|.+.+.+...
T Consensus 2 l~~~~~~~i~vp~~~ig~iIGkgG~~Ik~i~~~tg~~I~i~~~~~~~~~~~er~v~I~G~~~~v~~A~~~I~~~~~~~~~ 81 (178)
T 2anr_A 2 LGSQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTIEALNAVHGFIAEKIREMPQ 81 (178)
T ss_dssp -CCCEEEEEEEEHHHHHHHHCGGGHHHHHHHHHHCCEEEECCTTCBCTTSSEEEEEEEECHHHHHHHHHHHHHHHTCCCC
T ss_pred CCCCEEEEEEEChhHeeeeECCCcHHHHHHHHHhCCeEEEecCCCCCCCCCCceEEEEeCHHHHHHHHHHHHHHHhccCC
Confidence 46789999999999999999999999999999999999998876677889999999999999999999999977655421
Q ss_pred ccc-----------cCCCCCCceeEEEEEecCccceeecCCChHHHHHHHhcCCEEEEeccCCCCCCCCceEEEEEcCHH
Q 019754 111 AED-----------QADDVGTKTKLRLIVPNSSCGSIIGKAGATIKSFMDDSQAVIKISRLDHSYYGLNDRLVTLTGTLD 179 (336)
Q Consensus 111 ~~~-----------~~~~~~~~~~~~l~ip~~~~g~iIG~~G~~Ik~I~~~tga~I~i~~~~~~~~~~~~r~v~I~G~~~ 179 (336)
... .....+...+.+|.||.+++|+|||++|.+|++|+++|||+|+|.+.. .++...++.|+|+|+++
T Consensus 82 ~~~~~~~~~~~~~~~~~~~~~~~~~~i~Vp~~~vg~iIGkgG~~Ik~i~~~tga~I~i~~~~-~~~~~~~~~v~I~G~~~ 160 (178)
T 2anr_A 82 NVAKTEPVSILQPQTTVNPDRANQVKIIVPNSTAGLIIGKGGATVKAIMEQSGAWVQLSQKP-DGINLQNRVVTVSGEPE 160 (178)
T ss_dssp C-----------------CGGGGEEEEEEEHHHHHHHHCGGGHHHHHHHHHSSCEEEECCCC-----CCEEEEEEESSHH
T ss_pred ccccCCcccccCCccCCCCCCceEEEEEEchhheeeeECCCcHHHHHHHHHHCCEEEEeCCC-CCCCCCceEEEEEcCHH
Confidence 110 001122357889999999999999999999999999999999998742 24556789999999999
Q ss_pred HHHHHHHHHHHHhhcCc
Q 019754 180 EQMRALELILLKLSEDT 196 (336)
Q Consensus 180 ~v~~A~~~i~~~l~~~~ 196 (336)
++.+|+.+|.+++.+++
T Consensus 161 ~v~~A~~~I~~~i~e~p 177 (178)
T 2anr_A 161 QNRKAVELIIQKIQEDP 177 (178)
T ss_dssp HHHHHHHHHHHHHHSCC
T ss_pred HHHHHHHHHHHHHHhCC
Confidence 99999999999998753
|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A | Back alignment and structure |
|---|
| >3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
| >4hhu_A OR280; engineered protein, PSI-biology, structural genomi unknown function; HET: AE4 PG4; 2.00A {Synthetic construct} | Back alignment and structure |
|---|
| >2pt7_G HP1451, hypothetical protein; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1wh9_A 40S ribosomal protein S3; KH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ribosome; NMR {Homo sapiens} SCOP: d.52.3.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 336 | ||||
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 1e-18 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 7e-18 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 6e-16 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 6e-18 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 7e-17 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 2e-14 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 1e-16 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 1e-12 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 4e-11 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 3e-16 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 5e-15 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 1e-14 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 1e-15 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 2e-14 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 1e-12 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 2e-15 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 2e-14 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 5e-13 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 9e-15 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 6e-12 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 3e-11 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 1e-14 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 6e-14 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 2e-11 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 2e-13 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 3e-13 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 2e-12 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 2e-13 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 5e-12 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 4e-09 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 3e-13 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 1e-11 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 1e-11 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 5e-13 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 4e-11 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 2e-07 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 1e-12 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 2e-12 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 2e-11 | |
| d2ctma1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 3e-10 | |
| d2ctma1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 1e-08 | |
| d2ctma1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 1e-07 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 5e-10 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 1e-07 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 9e-06 | |
| d2ctja1 | 82 | d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T | 1e-09 | |
| d2ctja1 | 82 | d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T | 2e-07 | |
| d2ctja1 | 82 | d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T | 2e-07 | |
| d2je6i3 | 69 | d.51.1.1 (I:153-221) Exosome complex RNA-binding p | 2e-06 | |
| d2je6i3 | 69 | d.51.1.1 (I:153-221) Exosome complex RNA-binding p | 1e-04 | |
| d2je6i3 | 69 | d.51.1.1 (I:153-221) Exosome complex RNA-binding p | 0.001 | |
| d1tuaa1 | 84 | d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae | 2e-06 | |
| d1tuaa1 | 84 | d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae | 1e-04 | |
| d1tuaa1 | 84 | d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae | 1e-04 | |
| d2z0sa2 | 87 | d.51.1.1 (A:148-234) Exosome complex RNA-binding p | 4e-06 | |
| d2z0sa2 | 87 | d.51.1.1 (A:148-234) Exosome complex RNA-binding p | 3e-04 | |
| d1e3ha4 | 54 | d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ | 6e-05 | |
| d1e3ha4 | 54 | d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ | 2e-04 | |
| d1e3ha4 | 54 | d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ | 0.004 | |
| d2cpqa1 | 78 | d.51.1.1 (A:212-289) Fragile X mental retardation | 7e-05 | |
| d2cpqa1 | 78 | d.51.1.1 (A:212-289) Fragile X mental retardation | 0.001 | |
| d2ctfa1 | 90 | d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [T | 8e-05 | |
| d1tuaa2 | 104 | d.51.1.1 (A:85-188) Hypothetical protein APE0754 { | 6e-04 | |
| d1tuaa2 | 104 | d.51.1.1 (A:85-188) Hypothetical protein APE0754 { | 8e-04 | |
| d1hh2p3 | 68 | d.52.3.1 (P:277-344) Transcription factor NusA, C- | 0.002 | |
| d2asba3 | 67 | d.52.3.1 (A:263-329) Transcription factor NusA, C- | 0.004 |
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Neuro-oncological ventral antigen 2, nova-2, KH3 species: Human (Homo sapiens) [TaxId: 9606]
Score = 76.8 bits (189), Expect = 1e-18
Identities = 24/72 (33%), Positives = 48/72 (66%)
Query: 257 NSLTIGVADEHIGFVVGRGGRNIMEISQISGARIKVSDRGDFFSGTSERKVTISGPQRSI 316
+ + V + +G ++G+GG+ ++E +++GARI++S +G+F GT R+VTI+G +
Sbjct: 3 ELVEMAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFLPGTRNRRVTITGSPAAT 62
Query: 317 RTAESMIMQKVA 328
+ A+ +I Q+V
Sbjct: 63 QAAQYLISQRVT 74
|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 | Back information, alignment and structure |
|---|
| >d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} Length = 68 | Back information, alignment and structure |
|---|
| >d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} Length = 67 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 336 | |||
| d1j4wa2 | 71 | Far upstream binding element, FBP {Human (Homo sap | 99.71 | |
| d1dtja_ | 74 | Neuro-oncological ventral antigen 2, nova-2, KH3 { | 99.7 | |
| d1zzka1 | 75 | HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | 99.7 | |
| d1wvna1 | 70 | Poly(RC)-binding protein 1 {Human (Homo sapiens) [ | 99.69 | |
| d1j4wa1 | 74 | Far upstream binding element, FBP {Human (Homo sap | 99.66 | |
| d1dtja_ | 74 | Neuro-oncological ventral antigen 2, nova-2, KH3 { | 99.66 | |
| d2axya1 | 71 | Poly(RC)-binding protein 2 {Human (Homo sapiens) [ | 99.65 | |
| d1j4wa2 | 71 | Far upstream binding element, FBP {Human (Homo sap | 99.65 | |
| d1x4ma1 | 81 | Far upstream binding element, FBP {Mouse (Mus musc | 99.64 | |
| d2axya1 | 71 | Poly(RC)-binding protein 2 {Human (Homo sapiens) [ | 99.64 | |
| d1wvna1 | 70 | Poly(RC)-binding protein 1 {Human (Homo sapiens) [ | 99.63 | |
| d1x4na1 | 79 | Far upstream binding element, FBP {Mouse (Mus musc | 99.62 | |
| d1zzka1 | 75 | HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | 99.62 | |
| d1we8a_ | 104 | Tudor and KH domain containing protein, Tdrkh {Mou | 99.62 | |
| d1x4ma1 | 81 | Far upstream binding element, FBP {Mouse (Mus musc | 99.6 | |
| d1j4wa1 | 74 | Far upstream binding element, FBP {Human (Homo sap | 99.6 | |
| d2ctea1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.58 | |
| d2ctla1 | 84 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.57 | |
| d2ctma1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.57 | |
| d1x4na1 | 79 | Far upstream binding element, FBP {Mouse (Mus musc | 99.57 | |
| d1we8a_ | 104 | Tudor and KH domain containing protein, Tdrkh {Mou | 99.55 | |
| d1viga_ | 71 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.53 | |
| d2ctja1 | 82 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.52 | |
| d2ctma1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.49 | |
| d2ctea1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.48 | |
| d2ctla1 | 84 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.48 | |
| d2ctka1 | 91 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.48 | |
| d1viga_ | 71 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.45 | |
| d2ctja1 | 82 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.43 | |
| d2ctfa1 | 90 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.42 | |
| d2ba0a3 | 84 | Exosome complex RNA-binding protein 1, ECR1 {Archa | 99.38 | |
| d2ctka1 | 91 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.37 | |
| d2cpqa1 | 78 | Fragile X mental retardation syndrome related prot | 99.36 | |
| d2ctfa1 | 90 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.27 | |
| d2ba0a3 | 84 | Exosome complex RNA-binding protein 1, ECR1 {Archa | 99.21 | |
| d2cpqa1 | 78 | Fragile X mental retardation syndrome related prot | 99.16 | |
| d2je6i3 | 69 | Exosome complex RNA-binding protein 1, ECR1 {Sulfo | 99.02 | |
| d1tuaa1 | 84 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 99.0 | |
| d2z0sa2 | 87 | Exosome complex RNA-binding protein 1, ECR1 {Aerop | 98.97 | |
| d1tuaa1 | 84 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.83 | |
| d2je6i3 | 69 | Exosome complex RNA-binding protein 1, ECR1 {Sulfo | 98.83 | |
| d2z0sa2 | 87 | Exosome complex RNA-binding protein 1, ECR1 {Aerop | 98.82 | |
| d1tuaa2 | 104 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.78 | |
| d1e3ha4 | 54 | Polynucleotide phosphorylase/guanosine pentaphosph | 98.71 | |
| d1e3ha4 | 54 | Polynucleotide phosphorylase/guanosine pentaphosph | 98.69 | |
| d1tuaa2 | 104 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.53 | |
| d1k1ga_ | 122 | RNA splicing factor 1 {Human (Homo sapiens) [TaxId | 98.4 | |
| d1k1ga_ | 122 | RNA splicing factor 1 {Human (Homo sapiens) [TaxId | 98.38 | |
| d2bl5a1 | 134 | Quaking protein A (Xqua) {African clawed frog (Xen | 97.89 | |
| d2bl5a1 | 134 | Quaking protein A (Xqua) {African clawed frog (Xen | 97.87 | |
| d2asba3 | 67 | Transcription factor NusA, C-terminal domains {Myc | 96.36 | |
| d2asba3 | 67 | Transcription factor NusA, C-terminal domains {Myc | 96.3 | |
| d1hh2p3 | 68 | Transcription factor NusA, C-terminal domains {The | 96.0 | |
| d1hh2p3 | 68 | Transcription factor NusA, C-terminal domains {The | 95.78 | |
| d2ja9a2 | 85 | Ribosomal RNA-processing protein 40, RRP40 {Saccha | 93.59 | |
| d2ja9a2 | 85 | Ribosomal RNA-processing protein 40, RRP40 {Saccha | 90.68 | |
| d1wh9a_ | 92 | Ribosomal protein S3 N-terminal domain {Mouse (Mus | 90.44 | |
| d2uubc1 | 105 | Ribosomal protein S3 N-terminal domain {Thermus th | 83.83 | |
| d1egaa2 | 113 | GTPase Era C-terminal domain {Escherichia coli [Ta | 82.41 | |
| d1wh9a_ | 92 | Ribosomal protein S3 N-terminal domain {Mouse (Mus | 80.58 |
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Far upstream binding element, FBP species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.71 E-value=9.5e-18 Score=116.97 Aligned_cols=70 Identities=30% Similarity=0.463 Sum_probs=64.5
Q ss_pred EEEEEeccCcccceeccCCchHHHHHhHhCCeEEEccCCCCCCCCcceEEEEEcChHhHHHHHHHHHHHH
Q 019754 258 SLTIGVADEHIGFVVGRGGRNIMEISQISGARIKVSDRGDFFSGTSERKVTISGPQRSIRTAESMIMQKV 327 (336)
Q Consensus 258 ~~~v~vp~~~vg~IIGk~G~~I~~I~~~sga~I~i~~~~~~~~~~~~r~v~I~G~~~~v~~A~~~I~~~i 327 (336)
.++|.||..++|+|||++|++|++|++.|||+|.|++..++.+++.+|.|+|+|++++|+.|+.+|.++|
T Consensus 2 ~~~~~IP~~~vg~IIGk~G~~Ik~I~~~sga~I~i~~~~~~~~~~~~r~v~I~G~~~~v~~A~~~I~e~i 71 (71)
T d1j4wa2 2 EFNFIVPTGKTGLIIGKGGETIKSISQQSGARIELQRNPPPNADPNMKLFTIRGTPQQIDYARQLIEEKI 71 (71)
T ss_dssp EEEEEEETTTHHHHHCGGGHHHHHHHHHHCCEEEEECCCTTTSCTTEEEEEEECCHHHHHHHHHHHHHHC
T ss_pred EEEEEEChHhcceEECCCCcChHHHHhhcCcEEEEeecCCCCCCCCeEEEEEEeCHHHHHHHHHHHHhhC
Confidence 4689999999999999999999999999999999998766666778999999999999999999999874
|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2uubc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1egaa2 d.52.3.1 (A:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|