Citrus Sinensis ID: 019767


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330------
MAAKSPVKEPPGTSAVNPTTPLAPPPVKPELPSSSEPDVVNVPSYSRWFSFDSISECEVKFLPEFFDSRSPSKNPRVYRYYRDSIVKHYRENPSRKITFTDVRRTLVGDVGSIRRVFDFLETWGLINYFASVKTLKWEDKETKSSAASAESSSALKETSKRLCNGCKTLCTIACFACDKYDLTLCARCYVRGNHRVGVSSSDFRRVEISEEARSDWTEKETLQLLEAIMHFGDDWRKVAQHVSGKSEKDCITHFIKLPFGQEFICKESDSEDVDNKFFSINNPSDAVSESENVGATSPSKRMRLTPLADASNPIMAQLSCRLWLVSRLLKLLLEQL
cccccccccccccccccccccccccccccccccccccccEEccccccccccccccHHHHHHcccccccccccccHHHHHHHHHHHHHHHHccccccEEHHHHHHHccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHcccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccHHHHHHHcc
***************************************VNVPSYSRWFSFDSISECEVKFLPEFFDSRSPSKNPRVYRYYRDSIVKHYRENPSRKITFTDVRRTLVGDVGSIRRVFDFLETWGLINYFASVKTLKWEDKETK**************TSKRLCNGCKTLCTIACFACDKYDLTLCARCYVRGNHRVGVSSSDFRRVEISEEARSDWTEKETLQLLEAIMHFGDDWRKVAQHVSGKSEKDCITHFIKLPFGQEFIC***********************************************PIMAQLSCRLWLVSRLLKLLLEQL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAKSPVKEPPGTSAVNPTTPLAPPPVKPELPSSSEPDVVNVPSYSRWFSFDSISECEVKFLPEFFDSRSPSKNPRVYRYYRDSIVKHYRENPSRKITFTDVRRTLVGDVGSIRRVFDFLETWGLINYFASVKTLKWEDKETKSSAASAESSSALKETSKRLCNGCKTLCTIACFACDKYDLTLCARCYVRGNHRVGVSSSDFRRVEISEEARSDWTEKETLQLLEAIMHFGDDWRKVAQHVSGKSEKDCITHFIKLPFGQEFICKESDSEDVDNKFFSINNPSDAVSESENVGATSPSKRMRLTPLADASNPIMAQLSCRLWLVSRLLKLLLEQL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
SWI/SNF complex subunit SWI3B Component of a multiprotein complex equivalent of the SWI/SNF complex, an ATP-dependent chromatin-remodeling complex, which is required for the positive and negative regulation of gene expression of a large number of genes. It changes chromatin structure by altering DNA-histone contacts within a nucleosome, leading eventually to a change in nucleosome position, thus facilitating or repressing binding of gene-specific transcription factors. May play an essential role in the transition from the vegetative to the reproductive phase of development. May be a positive regulator of ABA signaling.probableQ84JG2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FQ3, chain A
Confidence level:very confident
Coverage over the Query: 46-130
View the alignment between query and template
View the model in PyMOL
Template: 2YUS, chain A
Confidence level:very confident
Coverage over the Query: 211-269
View the alignment between query and template
View the model in PyMOL
Template: 1TOT, chain A
Confidence level:confident
Coverage over the Query: 160-207
View the alignment between query and template
View the model in PyMOL