Query         019777
Match_columns 336
No_of_seqs    332 out of 1309
Neff          6.3 
Searched_HMMs 46136
Date          Fri Mar 29 04:27:45 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/019777.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/019777hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF12315 DUF3633:  Protein of u 100.0 1.8E-77   4E-82  536.3  15.0  194  134-335     1-194 (212)
  2 KOG2272 Focal adhesion protein  99.9 7.5E-26 1.6E-30  207.1   1.2  153    2-185    33-254 (332)
  3 KOG1703 Adaptor protein Enigma  99.9 8.5E-24 1.8E-28  214.9   8.2  302    9-335   151-456 (479)
  4 KOG1701 Focal adhesion adaptor  99.8 1.9E-22 4.2E-27  196.2  -4.7  145    1-176   294-438 (468)
  5 KOG1701 Focal adhesion adaptor  99.7 3.5E-18 7.6E-23  166.7   5.4  103    1-114   352-462 (468)
  6 KOG4577 Transcription factor L  99.6 4.8E-17   1E-21  151.8  -2.8  101    1-114    52-153 (383)
  7 KOG1044 Actin-binding LIM Zn-f  99.5 1.8E-15 3.9E-20  152.2   2.3  192    2-235    35-246 (670)
  8 KOG1703 Adaptor protein Enigma  99.5 3.3E-15 7.1E-20  152.2   3.6  153    1-179   322-477 (479)
  9 KOG2272 Focal adhesion protein  99.5 1.8E-15 3.9E-20  139.2  -1.2   99    1-113   213-311 (332)
 10 KOG1044 Actin-binding LIM Zn-f  99.4 5.5E-14 1.2E-18  141.6   1.2   97    1-112   152-248 (670)
 11 PF00412 LIM:  LIM domain;  Int  98.9 5.2E-10 1.1E-14   81.2   0.9   41    1-41     18-58  (58)
 12 PF00412 LIM:  LIM domain;  Int  98.8 9.8E-09 2.1E-13   74.5   4.4   56   45-113     1-56  (58)
 13 KOG1700 Regulatory protein MLP  98.5 3.3E-08   7E-13   90.2   0.4   98    2-113    27-165 (200)
 14 smart00132 LIM Zinc-binding do  97.5 6.4E-05 1.4E-09   49.4   2.6   38   44-92      1-38  (39)
 15 KOG4577 Transcription factor L  97.5 2.8E-06   6E-11   80.3  -5.8   76   36-128    27-102 (383)
 16 smart00132 LIM Zinc-binding do  97.0 0.00035 7.5E-09   45.8   1.2   20    1-20     19-38  (39)
 17 KOG0490 Transcription factor,   96.5 0.00032 6.9E-09   64.1  -2.3   99    2-113    16-118 (235)
 18 PF13485 Peptidase_MA_2:  Pepti  95.7   0.022 4.8E-07   46.1   5.2   43  220-262    19-63  (128)
 19 KOG1702 Nebulin repeat protein  94.7  0.0068 1.5E-07   55.3  -0.8   40    1-40     23-62  (264)
 20 KOG1700 Regulatory protein MLP  94.4   0.016 3.5E-07   53.0   1.0   40    2-41    128-167 (200)
 21 PF04450 BSP:  Peptidase of pla  86.5    0.63 1.4E-05   42.8   3.1   38  224-262    94-131 (205)
 22 PF14891 Peptidase_M91:  Effect  82.1     0.9   2E-05   40.4   2.1   20  225-244   102-121 (174)
 23 PF10026 DUF2268:  Predicted Zn  81.4     2.1 4.5E-05   38.7   4.2   45  224-268    63-113 (195)
 24 PF01433 Peptidase_M1:  Peptida  81.4    0.74 1.6E-05   45.1   1.4   43  226-268   295-339 (390)
 25 PF01431 Peptidase_M13:  Peptid  79.7    0.68 1.5E-05   41.7   0.5   17  225-241    35-51  (206)
 26 PF06114 DUF955:  Domain of unk  78.3     2.4 5.2E-05   33.6   3.3   52  213-264    29-86  (122)
 27 PF10263 SprT-like:  SprT-like   77.2     1.5 3.3E-05   37.6   1.9   22  221-242    55-76  (157)
 28 KOG0320 Predicted E3 ubiquitin  74.4     1.1 2.3E-05   40.4   0.2   49    7-55    129-180 (187)
 29 PF13699 DUF4157:  Domain of un  74.0       2 4.4E-05   33.4   1.7   18  226-243    61-78  (79)
 30 PF14835 zf-RING_6:  zf-RING of  73.3     3.4 7.4E-05   31.1   2.6   47   10-56      8-54  (65)
 31 PF10460 Peptidase_M30:  Peptid  71.8     4.5 9.8E-05   40.4   3.9   41  225-265   138-184 (366)
 32 PF10367 Vps39_2:  Vacuolar sor  71.7     2.8   6E-05   33.4   2.0   29   11-39     80-109 (109)
 33 PF08394 Arc_trans_TRASH:  Arch  71.2     1.1 2.5E-05   30.0  -0.3   33   45-91      1-33  (37)
 34 smart00731 SprT SprT homologue  70.1     3.3 7.1E-05   35.6   2.2   23  221-243    54-76  (146)
 35 KOG1702 Nebulin repeat protein  69.3    0.59 1.3E-05   42.9  -2.6   58   43-114     5-62  (264)
 36 TIGR02412 pepN_strep_liv amino  69.2     4.7  0.0001   44.4   3.8   40  227-266   288-329 (831)
 37 PRK14559 putative protein seri  66.8     5.8 0.00012   42.6   3.7   38   11-55      3-40  (645)
 38 PF07191 zinc-ribbons_6:  zinc-  65.4     3.7   8E-05   31.5   1.4   57   11-92      3-61  (70)
 39 KOG1813 Predicted E3 ubiquitin  63.3     3.9 8.5E-05   39.6   1.4   45   10-55    242-288 (313)
 40 PF09768 Peptidase_M76:  Peptid  61.7     4.5 9.8E-05   36.3   1.5   19  223-241    68-86  (173)
 41 PF01447 Peptidase_M4:  Thermol  61.7     4.9 0.00011   35.1   1.7   18  222-239   131-148 (150)
 42 smart00504 Ubox Modified RING   60.3     5.6 0.00012   28.5   1.5   45   10-55      2-48  (63)
 43 PRK14890 putative Zn-ribbon RN  60.0     5.5 0.00012   29.5   1.4   37   11-51      9-45  (59)
 44 COG2856 Predicted Zn peptidase  59.9      16 0.00035   33.8   4.8   55  213-267    59-120 (213)
 45 PRK04351 hypothetical protein;  59.6     6.8 0.00015   34.2   2.2   22  222-243    57-78  (149)
 46 COG1645 Uncharacterized Zn-fin  59.3     5.1 0.00011   34.4   1.3   23   11-38     30-52  (131)
 47 PF13920 zf-C3HC4_3:  Zinc fing  59.0     5.2 0.00011   27.8   1.1   43   11-54      4-49  (50)
 48 PF12773 DZR:  Double zinc ribb  58.8     9.3  0.0002   26.5   2.4   11  104-114    29-39  (50)
 49 cd04270 ZnMc_TACE_like Zinc-de  58.1     5.7 0.00012   37.2   1.6   18  221-238   162-179 (244)
 50 PF01435 Peptidase_M48:  Peptid  58.0     8.2 0.00018   34.6   2.6   29  214-242    73-105 (226)
 51 PF10367 Vps39_2:  Vacuolar sor  57.0     8.9 0.00019   30.4   2.4   27   84-111    81-107 (109)
 52 PF14471 DUF4428:  Domain of un  57.0     3.4 7.4E-05   29.6  -0.1   29   11-40      1-30  (51)
 53 PF06677 Auto_anti-p27:  Sjogre  56.0     7.4 0.00016   26.6   1.5   22   11-36     19-40  (41)
 54 PHA02456 zinc metallopeptidase  53.8     7.8 0.00017   32.5   1.5   17  228-244    81-98  (141)
 55 PF14446 Prok-RING_1:  Prokaryo  53.2     8.1 0.00017   28.1   1.3   39   11-51      7-50  (54)
 56 PF14634 zf-RING_5:  zinc-RING   52.9     7.4 0.00016   26.4   1.1   39   12-50      2-44  (44)
 57 KOG0320 Predicted E3 ubiquitin  52.7     6.2 0.00013   35.6   0.8   51   78-129   128-178 (187)
 58 PF14471 DUF4428:  Domain of un  52.4     8.5 0.00019   27.5   1.4   30   83-114     1-30  (51)
 59 PF10083 DUF2321:  Uncharacteri  52.3     5.2 0.00011   35.2   0.3   54   29-95     27-82  (158)
 60 PF01421 Reprolysin:  Reprolysi  50.5      15 0.00033   32.8   3.0   24  214-237   119-142 (199)
 61 PF11781 RRN7:  RNA polymerase   50.2     8.3 0.00018   25.6   0.9   26   10-39      9-34  (36)
 62 PF01258 zf-dskA_traR:  Prokary  48.1     1.9 4.1E-05   28.3  -2.4   28   12-39      6-33  (36)
 63 cd00162 RING RING-finger (Real  48.0     5.9 0.00013   25.5  -0.0   40   12-51      2-44  (45)
 64 PF02163 Peptidase_M50:  Peptid  47.8      14 0.00031   32.6   2.4   21  225-245     6-27  (192)
 65 smart00235 ZnMc Zinc-dependent  47.8     9.2  0.0002   32.0   1.1   11  228-238    88-98  (140)
 66 PLN03208 E3 ubiquitin-protein   47.5      19  0.0004   33.0   3.0   31    8-39     17-47  (193)
 67 PF14247 DUF4344:  Domain of un  47.4      26 0.00057   32.6   4.1   38  226-265    92-129 (220)
 68 PF10235 Cript:  Microtubule-as  47.3      12 0.00026   30.1   1.6   24   29-54     58-81  (90)
 69 cd04267 ZnMc_ADAM_like Zinc-de  47.3      13 0.00027   33.0   2.0   24  214-238   122-145 (192)
 70 KOG4739 Uncharacterized protei  46.3      14  0.0003   34.7   2.1   42   13-54      7-49  (233)
 71 cd04268 ZnMc_MMP_like Zinc-dep  46.2      11 0.00023   32.3   1.3   14  225-238    93-106 (165)
 72 cd06158 S2P-M50_like_1 Unchara  46.1      14 0.00031   33.0   2.1   18  225-242     8-25  (181)
 73 COG5152 Uncharacterized conser  46.0     5.5 0.00012   36.6  -0.6   45   10-55    197-243 (259)
 74 PF01863 DUF45:  Protein of unk  45.8      12 0.00027   33.3   1.7   27  212-238   150-176 (205)
 75 TIGR02411 leuko_A4_hydro leuko  45.7      15 0.00034   39.0   2.6   40  227-266   280-321 (601)
 76 COG1645 Uncharacterized Zn-fin  45.6      13 0.00028   31.9   1.6   24   84-114    31-54  (131)
 77 PRK04860 hypothetical protein;  45.5      15 0.00034   32.4   2.2   27  222-249    59-88  (160)
 78 KOG1420 Ca2+-activated K+ chan  44.4      27 0.00059   37.1   4.0    6  311-316    50-55  (1103)
 79 KOG2130 Phosphatidylserine-spe  43.9      23  0.0005   34.9   3.3   12  149-160   200-211 (407)
 80 PF00413 Peptidase_M10:  Matrix  43.6      13 0.00029   31.3   1.5   18  221-238   100-117 (154)
 81 TIGR02289 M3_not_pepF oligoend  42.3      30 0.00064   36.2   4.1   45  224-268   335-389 (549)
 82 PRK14559 putative protein seri  41.8      25 0.00055   37.8   3.5   22   83-113    29-50  (645)
 83 cd00203 ZnMc Zinc-dependent me  41.6      19 0.00042   30.6   2.2   16  223-238    93-108 (167)
 84 PF12674 Zn_ribbon_2:  Putative  41.3      11 0.00023   29.6   0.5   29   11-39      2-35  (81)
 85 COG2888 Predicted Zn-ribbon RN  41.3     9.9 0.00022   28.2   0.3   15   83-97     11-25  (61)
 86 KOG0490 Transcription factor,   40.7     5.3 0.00011   36.2  -1.6   51   77-128    19-69  (235)
 87 PF13688 Reprolysin_5:  Metallo  40.6      15 0.00033   32.5   1.4   18  221-238   137-154 (196)
 88 PF08219 TOM13:  Outer membrane  40.6      19 0.00041   28.0   1.7   25  223-248    49-73  (77)
 89 PRK00420 hypothetical protein;  40.5      20 0.00043   30.0   1.9   26   83-114    25-50  (112)
 90 PRK14873 primosome assembly pr  40.4      23 0.00049   38.3   2.9   52  186-238   502-555 (665)
 91 PF05299 Peptidase_M61:  M61 gl  39.5      15 0.00033   31.0   1.2   41  226-266     4-57  (122)
 92 PRK02870 heat shock protein Ht  39.4      24 0.00053   34.9   2.7   24  214-237   157-184 (336)
 93 KOG3714 Meprin A metalloprotea  39.3      14  0.0003   37.4   1.1   11  228-238   161-171 (411)
 94 PRK14714 DNA polymerase II lar  38.9      38 0.00082   39.1   4.3   14  230-243   906-919 (1337)
 95 KOG3624 M13 family peptidase [  38.8      14  0.0003   39.8   0.9   15  225-239   517-531 (687)
 96 PRK04897 heat shock protein Ht  38.6      13 0.00028   35.9   0.7   19  220-238   131-149 (298)
 97 KOG3931 Uncharacterized conser  38.4      17 0.00036   36.3   1.3   24  219-242    98-121 (484)
 98 KOG2932 E3 ubiquitin ligase in  37.9      16 0.00034   35.8   1.1   44   11-54     92-135 (389)
 99 cd06162 S2P-M50_PDZ_SREBP Ster  37.8      21 0.00045   34.5   1.9   17  225-241   134-150 (277)
100 COG1451 Predicted metal-depend  37.6      16 0.00035   34.0   1.1   27  212-238   161-187 (223)
101 PRK00420 hypothetical protein;  37.4      20 0.00043   30.0   1.5   23   11-37     25-47  (112)
102 PRK11827 hypothetical protein;  37.3      25 0.00054   26.2   1.8   15  137-151    36-50  (60)
103 PF13574 Reprolysin_2:  Metallo  37.1      20 0.00042   31.7   1.5   13  226-238   111-123 (173)
104 cd06159 S2P-M50_PDZ_Arch Uncha  36.9      23 0.00049   33.8   2.0   28  217-245   110-138 (263)
105 cd06161 S2P-M50_SpoIVFB SpoIVF  36.8      26 0.00057   31.9   2.4   22  224-245    36-58  (208)
106 PF04298 Zn_peptidase_2:  Putat  35.9      21 0.00046   33.3   1.6   29  219-247    82-110 (222)
107 cd04279 ZnMc_MMP_like_1 Zinc-d  35.7      19 0.00042   30.8   1.2   16  223-238   101-116 (156)
108 PRK00807 50S ribosomal protein  35.6      11 0.00023   27.2  -0.4   35   44-91      3-38  (52)
109 PF06689 zf-C4_ClpX:  ClpX C4-t  35.3      34 0.00074   23.2   2.2   31   83-113     3-33  (41)
110 PRK03001 M48 family peptidase;  35.0      18  0.0004   34.5   1.1   18  221-238   119-136 (283)
111 cd06164 S2P-M50_SpoIVFB_CBS Sp  34.8      27 0.00059   32.4   2.2   22  224-245    51-73  (227)
112 PRK14015 pepN aminopeptidase N  34.7      37 0.00081   37.9   3.5   41  226-266   296-338 (875)
113 PRK03072 heat shock protein Ht  34.6      18 0.00038   34.8   0.9   20  219-238   120-139 (288)
114 PRK05457 heat shock protein Ht  34.5      19  0.0004   34.7   1.0   19  220-238   128-146 (284)
115 PHA03309 transcriptional regul  34.4      31 0.00066   38.3   2.7   15  141-155  1494-1508(2033)
116 PF01400 Astacin:  Astacin (Pep  34.2      32  0.0007   30.9   2.5   17  222-238    75-91  (191)
117 PF10463 Peptidase_U49:  Peptid  34.2      44 0.00096   30.8   3.4   48  221-268    96-144 (206)
118 PRK03982 heat shock protein Ht  34.2      20 0.00043   34.3   1.2   18  221-238   120-137 (288)
119 cd04281 ZnMc_BMP1_TLD Zinc-dep  34.1      21 0.00045   32.7   1.2   11  228-238    89-99  (200)
120 PF06037 DUF922:  Bacterial pro  33.8      64  0.0014   28.4   4.2   30  213-242    57-102 (161)
121 cd05709 S2P-M50 Site-2 proteas  33.8      26 0.00056   30.7   1.8   21  225-245     7-28  (180)
122 PRK01345 heat shock protein Ht  33.6      31 0.00067   33.7   2.4   18  221-238   119-136 (317)
123 COG2191 Formylmethanofuran deh  33.3      19 0.00041   33.1   0.8   30   82-113   173-202 (206)
124 PF04228 Zn_peptidase:  Putativ  32.9      29 0.00063   33.7   2.1   46  223-268   167-227 (292)
125 cd04327 ZnMc_MMP_like_3 Zinc-d  32.9      26 0.00056   31.5   1.6   14  225-238    91-104 (198)
126 COG4784 Putative Zn-dependent   32.3      21 0.00046   35.6   1.0   47  214-261   107-158 (479)
127 PRK01265 heat shock protein Ht  31.7      35 0.00075   33.6   2.4   24  214-237   124-151 (324)
128 PRK02391 heat shock protein Ht  31.7      21 0.00045   34.5   0.9   19  220-238   127-145 (296)
129 cd06459 M3B_Oligoendopeptidase  31.6      48   0.001   32.9   3.5   38  224-261   220-260 (427)
130 KOG0978 E3 ubiquitin ligase in  31.2      11 0.00023   40.8  -1.3   46   10-56    644-692 (698)
131 COG0501 HtpX Zn-dependent prot  31.1      25 0.00054   33.1   1.3   18  221-238   152-169 (302)
132 cd04282 ZnMc_meprin Zinc-depen  30.9      25 0.00054   33.0   1.2   12  227-238   121-132 (230)
133 KOG3658 Tumor necrosis factor-  30.8      18  0.0004   38.8   0.3   22  218-239   382-405 (764)
134 cd04272 ZnMc_salivary_gland_MP  30.6      33 0.00071   31.3   2.0   15  224-238   143-157 (220)
135 PF13583 Reprolysin_4:  Metallo  30.4      26 0.00056   31.9   1.2   11  228-238   139-149 (206)
136 cd04269 ZnMc_adamalysin_II_lik  30.2      45 0.00098   29.5   2.7   16  223-238   128-143 (194)
137 cd06160 S2P-M50_like_2 Unchara  29.8      41 0.00088   30.3   2.4   24  224-247    39-63  (183)
138 PF13582 Reprolysin_3:  Metallo  29.8      26 0.00056   28.4   1.0   12  227-238   108-119 (124)
139 COG2738 Predicted Zn-dependent  29.6      27 0.00059   32.1   1.2   28  218-245    84-111 (226)
140 cd04283 ZnMc_hatching_enzyme Z  29.6      28 0.00061   31.4   1.3   12  227-238    78-89  (182)
141 PF02069 Metallothio_Pro:  Prok  29.4      29 0.00064   25.0   1.1   28   11-38      9-37  (52)
142 KOG1047 Bifunctional leukotrie  28.8      26 0.00056   37.0   1.0   13  227-239   289-301 (613)
143 TIGR02414 pepN_proteo aminopep  28.4      48   0.001   36.9   3.1   41  226-266   283-325 (863)
144 PRK09672 phage exclusion prote  28.2      69  0.0015   31.3   3.7   48  220-267   159-207 (305)
145 COG0308 PepN Aminopeptidase N   28.1      31 0.00067   38.3   1.5   38  229-268   310-351 (859)
146 KOG3314 Ku70-binding protein [  28.0      34 0.00074   30.6   1.5   16  226-241    91-106 (194)
147 cd02249 ZZ Zinc finger, ZZ typ  27.4      34 0.00074   23.5   1.1   14   10-23      1-14  (46)
148 PF13834 DUF4193:  Domain of un  27.4      21 0.00046   29.2   0.1   31   79-110    68-98  (99)
149 KOG2462 C2H2-type Zn-finger pr  27.4      38 0.00082   32.6   1.8   16    7-22    128-143 (279)
150 cd06461 M2_ACE Peptidase famil  27.1      58  0.0012   33.8   3.2   34  229-263   250-291 (477)
151 PF13248 zf-ribbon_3:  zinc-rib  26.4      39 0.00084   20.5   1.1   21   83-112     4-24  (26)
152 TIGR00181 pepF oligoendopeptid  26.3      32  0.0007   36.1   1.2   16  223-238   375-390 (591)
153 PF13923 zf-C3HC4_2:  Zinc fing  26.1      58  0.0012   21.2   2.0   36   84-121     1-36  (39)
154 smart00291 ZnF_ZZ Zinc-binding  25.4      41 0.00088   22.9   1.2   30   10-39      5-36  (44)
155 cd04278 ZnMc_MMP Zinc-dependen  25.0      34 0.00073   29.4   0.9   16  222-237   103-118 (157)
156 PF05572 Peptidase_M43:  Pregna  25.0      39 0.00084   29.5   1.3   19  222-241    65-83  (154)
157 PRK11595 DNA utilization prote  24.8      46 0.00099   30.7   1.8   37   11-53      7-45  (227)
158 cd04280 ZnMc_astacin_like Zinc  24.7      36 0.00079   30.2   1.1   12  227-238    75-86  (180)
159 PF07607 DUF1570:  Protein of u  24.3      85  0.0018   26.7   3.2   32  228-259     3-38  (128)
160 PF11928 DUF3446:  Domain of un  24.1      85  0.0018   24.9   2.9    9  252-260    17-25  (84)
161 PHA02624 large T antigen; Prov  23.8 1.6E+02  0.0034   31.9   5.7   23  302-324   149-171 (647)
162 PF12156 ATPase-cat_bd:  Putati  23.4      54  0.0012   25.9   1.7   10   44-53      2-11  (88)
163 COG2835 Uncharacterized conser  23.4      61  0.0013   24.1   1.9   40   82-149     9-48  (60)
164 PRK12495 hypothetical protein;  23.3      39 0.00085   31.5   1.0   25    8-37     41-65  (226)
165 cd06163 S2P-M50_PDZ_RseP-like   22.8      54  0.0012   29.5   1.8   21  225-245     8-29  (182)
166 KOG2661 Peptidase family M48 [  22.6      55  0.0012   32.6   1.9   27  215-241   259-290 (424)
167 PF04570 DUF581:  Protein of un  22.4      54  0.0012   24.2   1.4   30   84-113    19-49  (58)
168 smart00834 CxxC_CXXC_SSSS Puta  22.2      43 0.00093   21.8   0.8   11   10-20      6-16  (41)
169 COG3590 PepO Predicted metallo  21.8      23  0.0005   37.5  -0.8   16  226-241   487-502 (654)
170 PF09471 Peptidase_M64:  IgA Pe  21.3      47   0.001   31.7   1.2   18  225-242   215-232 (264)
171 PF12725 DUF3810:  Protein of u  21.2      50  0.0011   32.3   1.4   34  220-263   190-223 (318)
172 PF09723 Zn-ribbon_8:  Zinc rib  21.2      47   0.001   22.5   0.8   12   10-21      6-17  (42)
173 KOG4443 Putative transcription  21.1      50  0.0011   35.5   1.4   17  315-331   483-499 (694)
174 KOG0823 Predicted E3 ubiquitin  21.0      84  0.0018   29.5   2.7   54    8-64     46-104 (230)
175 PF06827 zf-FPG_IleRS:  Zinc fi  20.6      65  0.0014   19.9   1.3   12   43-54      2-13  (30)
176 cd06258 Peptidase_M3_like The   20.3 1.5E+02  0.0032   29.0   4.5   32  228-259   156-191 (365)
177 PF01432 Peptidase_M3:  Peptida  20.2 1.6E+02  0.0035   29.8   4.9   16  226-241   242-257 (458)
178 cd02336 ZZ_RSC8 Zinc finger, Z  20.1      86  0.0019   21.8   2.0   30   83-113     2-32  (45)

No 1  
>PF12315 DUF3633:  Protein of unknown function (DUF3633);  InterPro: IPR022087  This domain family is found in bacteria and eukaryotes, and is approximately 210 amino acids in length. The family is found in association with PF00412 from PFAM. 
Probab=100.00  E-value=1.8e-77  Score=536.27  Aligned_cols=194  Identities=78%  Similarity=1.208  Sum_probs=182.6

Q ss_pred             hccceeccccccchhcHHHHHHhhcCcCCCCCCCCCcCCccccccceecceecccccCCCcccccccccccccccceeEE
Q 019777          134 GLNMKVEQQVPLLLVERQALNEAMEGEKNGHHHLPETRGLCLSEEQTVTTVLRRPRIGAGYRLIDMITEPYRLIRRCEVT  213 (336)
Q Consensus       134 glg~~i~~~~p~~lV~~~ALn~a~~~e~~g~~h~~~~rGl~~~E~~~~~s~~~~~r~~~~~~~~~~~t~~~~~~~~~~v~  213 (336)
                      ||||||++++||+||+++|||+|.++|++|++|.++|||||++|+|+++++.|+|++++++++++|+|+|++++|+|+||
T Consensus         1 ~lnmki~q~~PllLVe~~aLN~a~~~Ek~~~~~~~~tRGLclseeq~v~sv~~~p~~~~~~~~~~~~~e~~~~~~~~eV~   80 (212)
T PF12315_consen    1 GLNMKIEQEIPLLLVERQALNEAEEGEKIGHHHMPETRGLCLSEEQTVTSVLRRPRMGPGNQLIDMSTEPQRLTRGCEVT   80 (212)
T ss_pred             CCCCcccCCCCeEEecHHHHHHHHhhccCCCCCCeeeeeeeeeeeEEEEEEEecCCcCCCCccceeeecceeeccceeEE
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEecCCChhhhhhhHHHHHHHHHHHhcCCCCCCcchhhhHHHHHHHHhhhcccccCCCCCccCCCCCCCCCCCCCCCC
Q 019777          214 AILILYGLPRLLTGSILAHEMMHAWLRLKGYPNLRPDVEEGICQVLAHMWLESEIYSGSGSDVASSSSSSASSSSSSPSS  293 (336)
Q Consensus       214 ~ilvl~glp~~~~~~~lahe~~ha~l~~~g~~~l~~~veeg~cq~~a~~wl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  293 (336)
                      +|+|||||||++||||||||+|||||||+||++|+|+||||||||||||||+++++++++        +++++|+|++++
T Consensus        81 ~Ilvl~GLPrll~gsiLAHE~mHa~Lrl~g~~~L~~~vEEGiCqvla~~wL~~~~~~~~~--------~~~~~s~~~s~~  152 (212)
T PF12315_consen   81 AILVLYGLPRLLTGSILAHELMHAWLRLNGFPNLSPEVEEGICQVLAYLWLESELASGSG--------SSSSSSSSSSSS  152 (212)
T ss_pred             EEEEECCCCHHHHhhHHHHHHHHHHhcccCCCCCChHHHHHHHHHHHHHHHhhhhhcccC--------CcccccCCCCCC
Confidence            999999999999999999999999999999999999999999999999999999998765        111234455566


Q ss_pred             CCCCCCCCCCchHHHHHHHHHhhhhhcCCCCCCchhhhhhhc
Q 019777          294 SSTSSKKGKRSDFEKDLGKFFKHQIESDTSSAYGDGLGKVVR  335 (336)
Q Consensus       294 ~~~~~~~~~~~~~~~~l~~~~~~~i~~d~s~~yg~gfr~~~~  335 (336)
                      ++++||||++++||+||++||+||||+|+|||||||||+|++
T Consensus       153 ~~~~skkg~~s~~E~kL~~f~~~qIe~D~SpvYGdGFRaa~~  194 (212)
T PF12315_consen  153 ASSSSKKGAKSQFEKKLGEFFKHQIETDTSPVYGDGFRAANE  194 (212)
T ss_pred             cccccccccccHHHHHHHHHHHHHhccCCCcccchHHHHHHH
Confidence            677889999999999999999999999999999999999985


No 2  
>KOG2272 consensus Focal adhesion protein PINCH-1, contains LIM domains [Signal transduction mechanisms; Cytoskeleton]
Probab=99.91  E-value=7.5e-26  Score=207.08  Aligned_cols=153  Identities=27%  Similarity=0.498  Sum_probs=127.2

Q ss_pred             CCcccCCCeeecCCCCCCCCCceeecCCccccccccccccCCcCcccCCcccCCCCceEEEeeec---------------
Q 019777            2 EAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNFIPTNSAGLIEYRAHP---------------   66 (336)
Q Consensus         2 g~~wH~~CF~C~~C~~~L~~~~F~~~dg~~yC~~CY~~~~~pkC~~C~~~I~~~~~g~i~~~~~~---------------   66 (336)
                      |..||.+||+|+.|-.|+.+..|++.+|+.||+.||+.+|+|.|..|+++|.+.   +|.++..+               
T Consensus        33 ge~wH~~CFvCAQCf~pf~~g~~~efEgRkYCEhDF~~LfaPcC~kC~EFiiGr---VikamnnSwHp~CF~Cd~Cn~~L  109 (332)
T KOG2272|consen   33 GELWHEQCFVCAQCFRPFPDGIFYEFEGRKYCEHDFHVLFAPCCGKCGEFIIGR---VIKAMNNSWHPACFRCDLCNKHL  109 (332)
T ss_pred             chhhHHHHHHHHHhcCcCCCceeEEecCcccccccchhhhchhhcccccchhhH---HHHhhccccCcccchhHHHHHHH
Confidence            578999999999999999999999999999999999999999999999999874   33333222               


Q ss_pred             --------------------------------------------ccccccCCCCcCCCCCccCCCCccCCCCCceEEcCC
Q 019777           67 --------------------------------------------FWLQKYCPSHERDGTPRCCSCERMEPRDTKYLSLDD  102 (336)
Q Consensus        67 --------------------------------------------fW~qkyCp~H~H~~CF~C~~C~~~l~~~~~f~~~~d  102 (336)
                                                                  |-+..|     |+..|+|..|++.|..+.+-+   .
T Consensus       110 ad~gf~rnqgr~LC~~Cn~k~Ka~~~g~YvC~KCh~~iD~~~l~fr~d~y-----H~yHFkCt~C~keL~sdaRev---k  181 (332)
T KOG2272|consen  110 ADQGFYRNQGRALCRECNQKEKAKGRGRYVCQKCHAHIDEQPLTFRGDPY-----HPYHFKCTTCGKELTSDAREV---K  181 (332)
T ss_pred             hhhhhHhhcchHHhhhhhhhhcccccceeehhhhhhhcccccccccCCCC-----Cccceecccccccccchhhhh---c
Confidence                                                        111223     555588999999998776643   7


Q ss_pred             CceeccchhhhcccCCCCCCchhhHHHHHHhhccceeccccccchhcHHHHHHhhc----------CcCCCCCCCCCcCC
Q 019777          103 GRKLCLECLDSAIMDTHECQPLYLEIQEFYEGLNMKVEQQVPLLLVERQALNEAME----------GEKNGHHHLPETRG  172 (336)
Q Consensus       103 G~~yC~~C~~~~v~~~~~C~~c~~~I~~f~~glg~~i~~~~p~~lV~~~ALn~a~~----------~e~~g~~h~~~~rG  172 (336)
                      |.+||+.|+++  |..++|.+|.+||.+           ++      +.|||++|+          +||.||.|| |++|
T Consensus       182 ~eLyClrChD~--mgipiCgaC~rpIee-----------rv------i~amgKhWHveHFvCa~CekPFlGHrHY-EkkG  241 (332)
T KOG2272|consen  182 GELYCLRCHDK--MGIPICGACRRPIEE-----------RV------IFAMGKHWHVEHFVCAKCEKPFLGHRHY-EKKG  241 (332)
T ss_pred             cceeccccccc--cCCcccccccCchHH-----------HH------HHHhccccchhheeehhcCCcccchhhh-hhcC
Confidence            89999999999  899999999988863           43      789999995          468999998 9999


Q ss_pred             ccccccceeccee
Q 019777          173 LCLSEEQTVTTVL  185 (336)
Q Consensus       173 l~~~E~~~~~s~~  185 (336)
                      |+|||+||+..+.
T Consensus       242 laYCe~h~~qLfG  254 (332)
T KOG2272|consen  242 LAYCETHYHQLFG  254 (332)
T ss_pred             chhHHHHHHHHhh
Confidence            9999999986654


No 3  
>KOG1703 consensus Adaptor protein Enigma and related PDZ-LIM proteins [Signal transduction mechanisms; Cytoskeleton]
Probab=99.89  E-value=8.5e-24  Score=214.90  Aligned_cols=302  Identities=43%  Similarity=0.675  Sum_probs=247.4

Q ss_pred             CeeecCCCCCCCCCceeecCCcccccccccc-ccCCcCcccCCcccCCCCceEEEeeecccccccCCCCcCCCCCccCCC
Q 019777            9 CFRCHSCNLPITDVEFSMSGNRPYHKHCYKE-QHHPKCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSC   87 (336)
Q Consensus         9 CF~C~~C~~~L~~~~F~~~dg~~yC~~CY~~-~~~pkC~~C~~~I~~~~~g~i~~~~~~fW~qkyCp~H~H~~CF~C~~C   87 (336)
                      ||.|..|..++          ..+...+|.. ...+.+.++...|.....+.+.++...+|.|+||+.|.+.....|..|
T Consensus       151 ~~~~~~~~~p~----------~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~tp~~~~~  220 (479)
T KOG1703|consen  151 CFQCKRCSEPL----------SGFPKPSYHESGRSKNEDVEEASSPSSRAGLILSRSHPFWKQKYCPSHENDGTPKCCSC  220 (479)
T ss_pred             hhhhccccccc----------CCccccccccccccccccccccccccccccccccccchhhhhcccccccCCCCCCcccc
Confidence            55666666665          2334455554 366789999999987766778889999999999999999999999999


Q ss_pred             CccCCCCCceEEcCCCceeccchhhhcccCCCCCCchhhHHHHHHhhccceeccccccchhcHHHHHHhhcCcCCCCCCC
Q 019777           88 ERMEPRDTKYLSLDDGRKLCLECLDSAIMDTHECQPLYLEIQEFYEGLNMKVEQQVPLLLVERQALNEAMEGEKNGHHHL  167 (336)
Q Consensus        88 ~~~l~~~~~f~~~~dG~~yC~~C~~~~v~~~~~C~~c~~~I~~f~~glg~~i~~~~p~~lV~~~ALn~a~~~e~~g~~h~  167 (336)
                      .+..+.+..+..+.+++.+|.+|....+++.+++++....+..++.+..+++++..+++++...+++++-...+....|.
T Consensus       221 ~r~e~~~~~~~~l~~~~~~~~~~~~~~~~~~p~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  300 (479)
T KOG1703|consen  221 ERLEPLDTRYVELADGRALCLECMGSASMDSPECQPLVSAPRPASEGLHMKVEKELPLLLVESEALKKLREEEKPAEYHN  300 (479)
T ss_pred             cccccccccceecccchhhhhhccCCcccCCCccCcceecccccccccccccccccchhhcccccccccccccccccccc
Confidence            99886688888998889999999987789999999999999999999999999999999999999999988777665554


Q ss_pred             CCcCCccccccceecceecccccCCCcccccccccccccccceeEEEEEEecCCChhhhhhhHHHHHHHHHHHhcCCCCC
Q 019777          168 PETRGLCLSEEQTVTTVLRRPRIGAGYRLIDMITEPYRLIRRCEVTAILILYGLPRLLTGSILAHEMMHAWLRLKGYPNL  247 (336)
Q Consensus       168 ~~~rGl~~~E~~~~~s~~~~~r~~~~~~~~~~~t~~~~~~~~~~v~~ilvl~glp~~~~~~~lahe~~ha~l~~~g~~~l  247 (336)
                       .++++|..+.++++++         ..+.++.++..+....|++++|+++++.|+...|.+++||+||+|++.++++.+
T Consensus       301 -~~~p~c~~c~~~i~~~---------~~i~~~~~~~h~~~~~c~~~~~~~~~~~~~~~~g~~~c~~~~~~~~~p~C~~C~  370 (479)
T KOG1703|consen  301 -VTRPLCLSCNQKIRSV---------KVIVALGKEWHPEHFSCEVCAIVILDGGPRELDGKILCHECFHAPFRPNCKRCL  370 (479)
T ss_pred             -cccccccccccCcccc---------eeEeeccccccccceeeccccccccCCCccccCCCccHHHHHHHhhCccccccC
Confidence             8899999999998553         345678888888889999999999999999999999999999999999999999


Q ss_pred             CcchhhhHHHHHHHHhhhcccccCCC-CCccCCCCCCCCCCCCCCCCCCCCCCCCC--CchHHHHHHHHHhhhhhcCCCC
Q 019777          248 RPDVEEGICQVLAHMWLESEIYSGSG-SDVASSSSSSASSSSSSPSSSSTSSKKGK--RSDFEKDLGKFFKHQIESDTSS  324 (336)
Q Consensus       248 ~~~veeg~cq~~a~~wl~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~l~~~~~~~i~~d~s~  324 (336)
                      .+.+||+||++ +.+|++..-+-..- .....    .+....+..+......++..  +..++++.++|+.++|+.|.++
T Consensus       371 ~~i~~~~v~a~-~~~wH~~cf~C~~C~~~~~~----~~~~~~~~~pyce~~~~~~~~~~~~~~~~p~~~~~~~ie~~~~~  445 (479)
T KOG1703|consen  371 LPILEEGVCAL-GRLWHPECFVCADCGKPLKN----SSFFESDGEPYCEDHYKKLFTTKCDYCKKPVEFGSRQIEADGSP  445 (479)
T ss_pred             CchHHhHhhhc-cCeechhceeeecccCCCCC----CcccccCCccchhhhHhhhccccchhccchhHhhhhHhhccCcc
Confidence            99999999999 99999998765422 11110    00111222222233334443  7788999999999999999999


Q ss_pred             CCchhhhhhhc
Q 019777          325 AYGDGLGKVVR  335 (336)
Q Consensus       325 ~yg~gfr~~~~  335 (336)
                      .||||||.++.
T Consensus       446 ~h~~~F~c~~c  456 (479)
T KOG1703|consen  446 FHGDCFRCANC  456 (479)
T ss_pred             ccccceehhhh
Confidence            99999998864


No 4  
>KOG1701 consensus Focal adhesion adaptor protein Paxillin and related LIM proteins [Signal transduction mechanisms]
Probab=99.82  E-value=1.9e-22  Score=196.19  Aligned_cols=145  Identities=20%  Similarity=0.407  Sum_probs=124.5

Q ss_pred             CCCcccCCCeeecCCCCCCCCCceeecCCccccccccccccCCcCcccCCcccCCCCceEEEeeecccccccCCCCcCCC
Q 019777            1 MEAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDG   80 (336)
Q Consensus         1 lg~~wH~~CF~C~~C~~~L~~~~F~~~dg~~yC~~CY~~~~~pkC~~C~~~I~~~~~g~i~~~~~~fW~qkyCp~H~H~~   80 (336)
                      |++.||.+||+|..|++.|.++.||..|+++||+.||.+ ...||.+|+++|.+.   ++.+.++.|          |++
T Consensus       294 m~~~fHv~CFtC~~C~r~L~Gq~FY~v~~k~~CE~cyq~-tlekC~~Cg~~I~d~---iLrA~Gkay----------Hp~  359 (468)
T KOG1701|consen  294 MDQLFHVQCFTCRTCRRQLAGQSFYQVDGKPYCEGCYQD-TLEKCNKCGEPIMDR---ILRALGKAY----------HPG  359 (468)
T ss_pred             hhhhhcccceehHhhhhhhccccccccCCcccchHHHHH-HHHHHhhhhhHHHHH---HHHhccccc----------CCC
Confidence            789999999999999999999999999999999999986 678999999999975   789999998          999


Q ss_pred             CCccCCCCccCCCCCceEEcCCCceeccchhhhcccCCCCCCchhhHHHHHHhhccceeccccccchhcHHHHHHhhcCc
Q 019777           81 TPRCCSCERMEPRDTKYLSLDDGRKLCLECLDSAIMDTHECQPLYLEIQEFYEGLNMKVEQQVPLLLVERQALNEAMEGE  160 (336)
Q Consensus        81 CF~C~~C~~~l~~~~~f~~~~dG~~yC~~C~~~~v~~~~~C~~c~~~I~~f~~glg~~i~~~~p~~lV~~~ALn~a~~~e  160 (336)
                      ||+|..|.+.|. |..|....++++||..||.+  .++++|..|.+||+        |-+++-  ..|.+.||++.+|.+
T Consensus       360 CF~Cv~C~r~ld-gipFtvd~~n~v~Cv~dfh~--kfAPrCs~C~~PI~--------P~~G~~--etvRvvamdr~fHv~  426 (468)
T KOG1701|consen  360 CFTCVVCARCLD-GIPFTVDSQNNVYCVPDFHK--KFAPRCSVCGNPIL--------PRDGKD--ETVRVVAMDRDFHVN  426 (468)
T ss_pred             ceEEEEeccccC-CccccccCCCceeeehhhhh--hcCcchhhccCCcc--------CCCCCc--ceEEEEEcccccccc
Confidence            999999999996 89998888999999999999  89999999999994        554332  235677888888765


Q ss_pred             CCCCCCCCCcCCcccc
Q 019777          161 KNGHHHLPETRGLCLS  176 (336)
Q Consensus       161 ~~g~~h~~~~rGl~~~  176 (336)
                      .-.    -|--|+-|+
T Consensus       427 CY~----CEDCg~~LS  438 (468)
T KOG1701|consen  427 CYK----CEDCGLLLS  438 (468)
T ss_pred             cee----hhhcCcccc
Confidence            421    155566666


No 5  
>KOG1701 consensus Focal adhesion adaptor protein Paxillin and related LIM proteins [Signal transduction mechanisms]
Probab=99.72  E-value=3.5e-18  Score=166.67  Aligned_cols=103  Identities=24%  Similarity=0.527  Sum_probs=91.0

Q ss_pred             CCCcccCCCeeecCCCCCCCCCceee-cCCccccccccccccCCcCcccCCcccCCCCc----eEEEeeecccccccCCC
Q 019777            1 MEAFWHPECFRCHSCNLPITDVEFSM-SGNRPYHKHCYKEQHHPKCDVCQNFIPTNSAG----LIEYRAHPFWLQKYCPS   75 (336)
Q Consensus         1 lg~~wH~~CF~C~~C~~~L~~~~F~~-~dg~~yC~~CY~~~~~pkC~~C~~~I~~~~~g----~i~~~~~~fW~qkyCp~   75 (336)
                      ||+.||+.||+|..|++.|++..|.+ .++++||.+||+++|+|+|++|+++|...++.    .|.++++.|        
T Consensus       352 ~GkayHp~CF~Cv~C~r~ldgipFtvd~~n~v~Cv~dfh~kfAPrCs~C~~PI~P~~G~~etvRvvamdr~f--------  423 (468)
T KOG1701|consen  352 LGKAYHPGCFTCVVCARCLDGIPFTVDSQNNVYCVPDFHKKFAPRCSVCGNPILPRDGKDETVRVVAMDRDF--------  423 (468)
T ss_pred             cccccCCCceEEEEeccccCCccccccCCCceeeehhhhhhcCcchhhccCCccCCCCCcceEEEEEccccc--------
Confidence            68999999999999999999999986 78999999999999999999999999986542    245666666        


Q ss_pred             CcCCCCCccCCCCccCC---CCCceEEcCCCceeccchhhhc
Q 019777           76 HERDGTPRCCSCERMEP---RDTKYLSLDDGRKLCLECLDSA  114 (336)
Q Consensus        76 H~H~~CF~C~~C~~~l~---~~~~f~~~~dG~~yC~~C~~~~  114 (336)
                        |.+|++|..|+..|.   .+...|.+ ||.++|+.|+.+.
T Consensus       424 --Hv~CY~CEDCg~~LS~e~e~qgCyPl-d~HllCk~Ch~~R  462 (468)
T KOG1701|consen  424 --HVNCYKCEDCGLLLSSEEEGQGCYPL-DGHLLCKTCHLKR  462 (468)
T ss_pred             --cccceehhhcCccccccCCCCcceec-cCceeechhhhhh
Confidence              999999999999986   36678899 9999999998764


No 6  
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription]
Probab=99.59  E-value=4.8e-17  Score=151.76  Aligned_cols=101  Identities=22%  Similarity=0.564  Sum_probs=89.8

Q ss_pred             CCCcccCCCeeecCCCCCCCCCceeecCCccccccccccccCCcCcccCCcccCCCCceE-EEeeecccccccCCCCcCC
Q 019777            1 MEAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNFIPTNSAGLI-EYRAHPFWLQKYCPSHERD   79 (336)
Q Consensus         1 lg~~wH~~CF~C~~C~~~L~~~~F~~~dg~~yC~~CY~~~~~pkC~~C~~~I~~~~~g~i-~~~~~~fW~qkyCp~H~H~   79 (336)
                      |++.||..|++|+.|+.+|++..| .++|.+||+++|.++|+.||..|...|++.  ++| .+.+..|          |.
T Consensus        52 l~R~wHs~CLkCs~C~~qL~drCF-sR~~s~yCkedFfKrfGTKCsaC~~GIpPt--qVVRkAqd~VY----------Hl  118 (383)
T KOG4577|consen   52 LDRHWHSSCLKCSDCHDQLADRCF-SREGSVYCKEDFFKRFGTKCSACQEGIPPT--QVVRKAQDFVY----------HL  118 (383)
T ss_pred             HhhhhhhhhcchhhhhhHHHHHHh-hcCCceeehHHHHHHhCCcchhhcCCCChH--HHHHHhhccee----------eh
Confidence            578999999999999999998655 589999999999999999999999999985  233 3445555          99


Q ss_pred             CCCccCCCCccCCCCCceEEcCCCceeccchhhhc
Q 019777           80 GTPRCCSCERMEPRDTKYLSLDDGRKLCLECLDSA  114 (336)
Q Consensus        80 ~CF~C~~C~~~l~~~~~f~~~~dG~~yC~~C~~~~  114 (336)
                      .||.|..|.+.|..|+.||..+|+++.|++.|+++
T Consensus       119 ~CF~C~iC~R~L~TGdEFYLmeD~rLvCK~DYE~A  153 (383)
T KOG4577|consen  119 HCFACFICKRQLATGDEFYLMEDARLVCKDDYETA  153 (383)
T ss_pred             hhhhhHhhhcccccCCeeEEeccceeehhhhHHHH
Confidence            99999999999999999999999999999999985


No 7  
>KOG1044 consensus Actin-binding LIM Zn-finger protein Limatin involved in axon guidance [Signal transduction mechanisms; Cytoskeleton]
Probab=99.54  E-value=1.8e-15  Score=152.19  Aligned_cols=192  Identities=15%  Similarity=0.260  Sum_probs=148.0

Q ss_pred             CCcccCCCeeecCCCCCCCCCceeecCCccccccccccccCCcCcccCCcccCCCCceEEEeeecccccccCCCCcCCCC
Q 019777            2 EAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDGT   81 (336)
Q Consensus         2 g~~wH~~CF~C~~C~~~L~~~~F~~~dg~~yC~~CY~~~~~pkC~~C~~~I~~~~~g~i~~~~~~fW~qkyCp~H~H~~C   81 (336)
                      ++.||..||.|..|++.|+...|+.+++.        +++++  ..|.+.|.++   +|.+.++.|          |+.|
T Consensus        35 d~~fhi~cf~c~~cg~~la~~gff~k~~~--------~~ygt--~~c~~~~~ge---vvsa~gkty----------h~~c   91 (670)
T KOG1044|consen   35 DNHFHINCFQCKKCGRNLAEGGFFTKPEN--------RLYGT--DDCRAFVEGE---VVSTLGKTY----------HPKC   91 (670)
T ss_pred             ccccceeeeeccccCCCcccccceecccc--------eeecc--cchhhhccce---eEeccccee----------cccc
Confidence            67899999999999999999999998775        45555  7899999986   789999988          9999


Q ss_pred             CccCCCCccCCCCCceEEcCCCceeccchhhhccc------CCCCCCchhhHHHHHHhhccceeccccccchhcHHHHHH
Q 019777           82 PRCCSCERMEPRDTKYLSLDDGRKLCLECLDSAIM------DTHECQPLYLEIQEFYEGLNMKVEQQVPLLLVERQALNE  155 (336)
Q Consensus        82 F~C~~C~~~l~~~~~f~~~~dG~~yC~~C~~~~v~------~~~~C~~c~~~I~~f~~glg~~i~~~~p~~lV~~~ALn~  155 (336)
                      |.|+.|..+++.|++- ........|..|...+-.      +...|.+|...|..          ++.      +-||++
T Consensus        92 f~cs~ck~pf~~g~~v-t~~gk~~~c~~c~~~~~~~p~~~~~ps~cagc~~~lk~----------gq~------llald~  154 (670)
T KOG1044|consen   92 FSCSTCKSPFKSGDKV-TFSGKECLCQTCSQPMPVSPAESYGPSTCAGCGEELKN----------GQA------LLALDK  154 (670)
T ss_pred             ceecccCCCCCCCCee-eecchhhhhhhhcCcccCCcccccCCccccchhhhhhc----------cce------eeeecc
Confidence            9999999999987774 554666889999766522      45679999887752          343      338888


Q ss_pred             hhcCc--------CCCCCCCCCcCCccccccceecceecccccCCC-----ccccccccccccccc-ceeEEEEEEecCC
Q 019777          156 AMEGE--------KNGHHHLPETRGLCLSEEQTVTTVLRRPRIGAG-----YRLIDMITEPYRLIR-RCEVTAILILYGL  221 (336)
Q Consensus       156 a~~~e--------~~g~~h~~~~rGl~~~E~~~~~s~~~~~r~~~~-----~~~~~~~t~~~~~~~-~~~v~~ilvl~gl  221 (336)
                      +||.-        ...++.|+.++|++|||.+|+.-+.  .+.-..     .++++.....++.+. ||....-+.--|-
T Consensus       155 qwhv~cfkc~~c~~vL~gey~skdg~pyce~dy~~~fg--vkc~~c~~fisgkvLqag~kh~HPtCARCsRCgqmF~eGE  232 (670)
T KOG1044|consen  155 QWHVSCFKCKSCSAVLNGEYMSKDGVPYCEKDYQAKFG--VKCEECEKFISGKVLQAGDKHFHPTCARCSRCGQMFGEGE  232 (670)
T ss_pred             ceeeeeeehhhhcccccceeeccCCCcchhhhhhhhcC--eehHHhhhhhhhhhhhccCcccCcchhhhhhhccccccch
Confidence            88642        3445668899999999999986654  111111     223455556677776 7888899999999


Q ss_pred             ChhhhhhhHHHHHH
Q 019777          222 PRLLTGSILAHEMM  235 (336)
Q Consensus       222 p~~~~~~~lahe~~  235 (336)
                      -+.|.||.+||.-.
T Consensus       233 EMYlQGs~iWHP~C  246 (670)
T KOG1044|consen  233 EMYLQGSEIWHPDC  246 (670)
T ss_pred             heeeccccccCCcc
Confidence            99999999999754


No 8  
>KOG1703 consensus Adaptor protein Enigma and related PDZ-LIM proteins [Signal transduction mechanisms; Cytoskeleton]
Probab=99.53  E-value=3.3e-15  Score=152.24  Aligned_cols=153  Identities=16%  Similarity=0.272  Sum_probs=119.4

Q ss_pred             CCCcccCCCeeecCCCCCCCCCceeecCCccccccccccccCCcCcccCCcccCCCCceEEEeeecccccccCCCCcCCC
Q 019777            1 MEAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDG   80 (336)
Q Consensus         1 lg~~wH~~CF~C~~C~~~L~~~~F~~~dg~~yC~~CY~~~~~pkC~~C~~~I~~~~~g~i~~~~~~fW~qkyCp~H~H~~   80 (336)
                      ||+.||+.+|.|..|...|....|...+|++||..||.+.+.|+|..|.++|.++   .|.+.++.          ||+.
T Consensus       322 ~~~~~h~~~~~c~~~~~~~~~~~~~~~~g~~~c~~~~~~~~~p~C~~C~~~i~~~---~v~a~~~~----------wH~~  388 (479)
T KOG1703|consen  322 LGKEWHPEHFSCEVCAIVILDGGPRELDGKILCHECFHAPFRPNCKRCLLPILEE---GVCALGRL----------WHPE  388 (479)
T ss_pred             ccccccccceeeccccccccCCCccccCCCccHHHHHHHhhCccccccCCchHHh---HhhhccCe----------echh
Confidence            6889999999999999999998998999999999999999999999999999987   46666543          4999


Q ss_pred             CCccCCCCccCCCCCceEEcCCCceeccchhhhcccCCCCCCchhhHHHH---HHhhccceeccccccchhcHHHHHHhh
Q 019777           81 TPRCCSCERMEPRDTKYLSLDDGRKLCLECLDSAIMDTHECQPLYLEIQE---FYEGLNMKVEQQVPLLLVERQALNEAM  157 (336)
Q Consensus        81 CF~C~~C~~~l~~~~~f~~~~dG~~yC~~C~~~~v~~~~~C~~c~~~I~~---f~~glg~~i~~~~p~~lV~~~ALn~a~  157 (336)
                      ||.|..|++.+. +..|+.. ||.+||..|+..  .+...|..|.+||..   +.+++|.++.+..-    .....++++
T Consensus       389 cf~C~~C~~~~~-~~~~~~~-~~~pyce~~~~~--~~~~~~~~~~~p~~~~~~~ie~~~~~~h~~~F----~c~~c~~~l  460 (479)
T KOG1703|consen  389 CFVCADCGKPLK-NSSFFES-DGEPYCEDHYKK--LFTTKCDYCKKPVEFGSRQIEADGSPFHGDCF----RCANCMKKL  460 (479)
T ss_pred             ceeeecccCCCC-CCccccc-CCccchhhhHhh--hccccchhccchhHhhhhHhhccCccccccce----ehhhhhccc
Confidence            999999999996 6666655 999999999998  566789889888763   44556666654431    122222222


Q ss_pred             cCcCCCCCCCCCcCCccccccc
Q 019777          158 EGEKNGHHHLPETRGLCLSEEQ  179 (336)
Q Consensus       158 ~~e~~g~~h~~~~rGl~~~E~~  179 (336)
                           ..+-+.++.+.+||..+
T Consensus       461 -----~~~~~~~~~~~p~c~~~  477 (479)
T KOG1703|consen  461 -----TKKTFFETLDKPLCQKH  477 (479)
T ss_pred             -----cCCceeecCCccccccC
Confidence                 22235678888888654


No 9  
>KOG2272 consensus Focal adhesion protein PINCH-1, contains LIM domains [Signal transduction mechanisms; Cytoskeleton]
Probab=99.50  E-value=1.8e-15  Score=139.18  Aligned_cols=99  Identities=20%  Similarity=0.507  Sum_probs=92.5

Q ss_pred             CCCcccCCCeeecCCCCCCCCCceeecCCccccccccccccCCcCcccCCcccCCCCceEEEeeecccccccCCCCcCCC
Q 019777            1 MEAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDG   80 (336)
Q Consensus         1 lg~~wH~~CF~C~~C~~~L~~~~F~~~dg~~yC~~CY~~~~~pkC~~C~~~I~~~~~g~i~~~~~~fW~qkyCp~H~H~~   80 (336)
                      ||+.||.++|+|+.|.+|+-+...|++.|.+||+++|.++|+..|..|+..|.+.   ++.+.++.|          -+.
T Consensus       213 mgKhWHveHFvCa~CekPFlGHrHYEkkGlaYCe~h~~qLfG~~CF~C~~~i~G~---vv~al~Kaw----------Cv~  279 (332)
T KOG2272|consen  213 MGKHWHVEHFVCAKCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFICNRVIGGD---VVSALNKAW----------CVE  279 (332)
T ss_pred             hccccchhheeehhcCCcccchhhhhhcCchhHHHHHHHHhhhhheecCCccCcc---HHHHhhhhh----------ccc
Confidence            7999999999999999999999999999999999999999999999999999985   788888884          677


Q ss_pred             CCccCCCCccCCCCCceEEcCCCceeccchhhh
Q 019777           81 TPRCCSCERMEPRDTKYLSLDDGRKLCLECLDS  113 (336)
Q Consensus        81 CF~C~~C~~~l~~~~~f~~~~dG~~yC~~C~~~  113 (336)
                      ||.|+.|++.|....+|+++ |-+|.|+.||++
T Consensus       280 cf~Cs~Cdkkl~~K~Kf~E~-DmkP~CKkCy~r  311 (332)
T KOG2272|consen  280 CFSCSTCDKKLTQKNKFYEF-DMKPVCKKCYDR  311 (332)
T ss_pred             cccccccccccccccceeee-ccchHHHHHHhh
Confidence            79999999999988899999 899999999986


No 10 
>KOG1044 consensus Actin-binding LIM Zn-finger protein Limatin involved in axon guidance [Signal transduction mechanisms; Cytoskeleton]
Probab=99.40  E-value=5.5e-14  Score=141.62  Aligned_cols=97  Identities=23%  Similarity=0.602  Sum_probs=85.7

Q ss_pred             CCCcccCCCeeecCCCCCCCCCceeecCCccccccccccccCCcCcccCCcccCCCCceEEEeeecccccccCCCCcCCC
Q 019777            1 MEAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDG   80 (336)
Q Consensus         1 lg~~wH~~CF~C~~C~~~L~~~~F~~~dg~~yC~~CY~~~~~pkC~~C~~~I~~~~~g~i~~~~~~fW~qkyCp~H~H~~   80 (336)
                      |++.||..||+|..|...|.+ +|..+||.|||..||++.|+.+|..|.++|.+.   ++.+.++.|          |+.
T Consensus       152 ld~qwhv~cfkc~~c~~vL~g-ey~skdg~pyce~dy~~~fgvkc~~c~~fisgk---vLqag~kh~----------HPt  217 (670)
T KOG1044|consen  152 LDKQWHVSCFKCKSCSAVLNG-EYMSKDGVPYCEKDYQAKFGVKCEECEKFISGK---VLQAGDKHF----------HPT  217 (670)
T ss_pred             eccceeeeeeehhhhcccccc-eeeccCCCcchhhhhhhhcCeehHHhhhhhhhh---hhhccCccc----------Ccc
Confidence            689999999999999999976 899999999999999999999999999999985   788888644          999


Q ss_pred             CCccCCCCccCCCCCceEEcCCCceeccchhh
Q 019777           81 TPRCCSCERMEPRDTKYLSLDDGRKLCLECLD  112 (336)
Q Consensus        81 CF~C~~C~~~l~~~~~f~~~~dG~~yC~~C~~  112 (336)
                      |-+|..|+.+|..|+..|.. ...++-..|-.
T Consensus       218 CARCsRCgqmF~eGEEMYlQ-Gs~iWHP~C~q  248 (670)
T KOG1044|consen  218 CARCSRCGQMFGEGEEMYLQ-GSEIWHPDCKQ  248 (670)
T ss_pred             hhhhhhhccccccchheeec-cccccCCcccc
Confidence            99999999999877776644 67777777764


No 11 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=98.87  E-value=5.2e-10  Score=81.21  Aligned_cols=41  Identities=44%  Similarity=1.189  Sum_probs=38.1

Q ss_pred             CCCcccCCCeeecCCCCCCCCCceeecCCcccccccccccc
Q 019777            1 MEAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQH   41 (336)
Q Consensus         1 lg~~wH~~CF~C~~C~~~L~~~~F~~~dg~~yC~~CY~~~~   41 (336)
                      +|+.||++||+|..|+++|.+..|+..+|++||+.||.++|
T Consensus        18 ~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~f   58 (58)
T PF00412_consen   18 MGKFWHPECFKCSKCGKPLNDGDFYEKDGKPYCKDCYQKRF   58 (58)
T ss_dssp             TTEEEETTTSBETTTTCBTTTSSEEEETTEEEEHHHHHHHT
T ss_pred             CCcEEEccccccCCCCCccCCCeeEeECCEEECHHHHhhhC
Confidence            47899999999999999999988999999999999998765


No 12 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=98.75  E-value=9.8e-09  Score=74.48  Aligned_cols=56  Identities=20%  Similarity=0.468  Sum_probs=45.7

Q ss_pred             CcccCCcccCCCCceEEEeeecccccccCCCCcCCCCCccCCCCccCCCCCceEEcCCCceeccchhhh
Q 019777           45 CDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCERMEPRDTKYLSLDDGRKLCLECLDS  113 (336)
Q Consensus        45 C~~C~~~I~~~~~g~i~~~~~~fW~qkyCp~H~H~~CF~C~~C~~~l~~~~~f~~~~dG~~yC~~C~~~  113 (336)
                      |..|+++|.+.. .++.+.++.|          |+.||+|..|+++|. +..|+.. ||++||..|+.+
T Consensus         1 C~~C~~~I~~~~-~~~~~~~~~~----------H~~Cf~C~~C~~~l~-~~~~~~~-~~~~~C~~c~~~   56 (58)
T PF00412_consen    1 CARCGKPIYGTE-IVIKAMGKFW----------HPECFKCSKCGKPLN-DGDFYEK-DGKPYCKDCYQK   56 (58)
T ss_dssp             BTTTSSBESSSS-EEEEETTEEE----------ETTTSBETTTTCBTT-TSSEEEE-TTEEEEHHHHHH
T ss_pred             CCCCCCCccCcE-EEEEeCCcEE----------EccccccCCCCCccC-CCeeEeE-CCEEECHHHHhh
Confidence            789999999864 2335777764          999999999999997 4447666 899999999976


No 13 
>KOG1700 consensus Regulatory protein MLP and related LIM proteins [Signal transduction mechanisms; Cytoskeleton]
Probab=98.47  E-value=3.3e-08  Score=90.24  Aligned_cols=98  Identities=27%  Similarity=0.554  Sum_probs=76.5

Q ss_pred             CCcccCCCeeecCCCCCCCCCceeecCCccccccccccccCC--------------------------------------
Q 019777            2 EAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHP--------------------------------------   43 (336)
Q Consensus         2 g~~wH~~CF~C~~C~~~L~~~~F~~~dg~~yC~~CY~~~~~p--------------------------------------   43 (336)
                      |..||+.||+|..|.+.|....+..+++.+||+.||...++|                                      
T Consensus        27 g~~~hk~c~~c~~~~k~l~~~~~~~~e~~~yc~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g  106 (200)
T KOG1700|consen   27 GVDFHKECFKCEKCKKTLTLSGYSEHEGVPYCKNCHVAQFGPKGGGFGKGFQKAGGLGKDGKSLNESKPNQSAKFQVFAG  106 (200)
T ss_pred             CcchhhhHHhccccccccccccccccccccccccchHhhhCcccccccccccccCCCCcccccccccccccchhHHhhhc
Confidence            678999999999999999998999999999999987554332                                      


Q ss_pred             ---cCcccCCcccCCCCceEEEeeecccccccCCCCcCCCCCccCCCCccCCCCCceEEcCCCceeccchhhh
Q 019777           44 ---KCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCERMEPRDTKYLSLDDGRKLCLECLDS  113 (336)
Q Consensus        44 ---kC~~C~~~I~~~~~g~i~~~~~~fW~qkyCp~H~H~~CF~C~~C~~~l~~~~~f~~~~dG~~yC~~C~~~  113 (336)
                         .|..|++.+.+.+  .+...+..|          |..||+|..|+..|. ...|... +|.+||...+..
T Consensus       107 ~~~~c~~c~k~vy~~E--k~~~~~~~~----------hk~cfrc~~~~~~ls-~~~~~~~-~g~l~~~~~~~~  165 (200)
T KOG1700|consen  107 EKEKCARCQKTVYPLE--KVTGNGLEF----------HKSCFRCTHCGKKLS-PKNYAAL-EGVLYCKHHFAQ  165 (200)
T ss_pred             cccccccccceeeehH--HHhhhhhhh----------hhhheeecccccccC-Ccchhhc-CCccccchhhhe
Confidence               3888888776542  344555554          999999999999996 5566554 778888665544


No 14 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=97.54  E-value=6.4e-05  Score=49.37  Aligned_cols=38  Identities=16%  Similarity=0.318  Sum_probs=30.2

Q ss_pred             cCcccCCcccCCCCceEEEeeecccccccCCCCcCCCCCccCCCCccCC
Q 019777           44 KCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCERMEP   92 (336)
Q Consensus        44 kC~~C~~~I~~~~~g~i~~~~~~fW~qkyCp~H~H~~CF~C~~C~~~l~   92 (336)
                      +|..|+++|.+.. ..+.+.+..|          |..||+|..|+++|.
T Consensus         1 ~C~~C~~~i~~~~-~~~~~~~~~~----------H~~Cf~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGE-LVLRALGKVW----------HPECFKCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCc-EEEEeCCccc----------cccCCCCcccCCcCc
Confidence            5899999998852 3566666653          999999999999884


No 15 
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription]
Probab=97.52  E-value=2.8e-06  Score=80.30  Aligned_cols=76  Identities=17%  Similarity=0.324  Sum_probs=59.5

Q ss_pred             ccccccCCcCcccCCcccCCCCceEEEeeecccccccCCCCcCCCCCccCCCCccCCCCCceEEcCCCceeccchhhhcc
Q 019777           36 CYKEQHHPKCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCERMEPRDTKYLSLDDGRKLCLECLDSAI  115 (336)
Q Consensus        36 CY~~~~~pkC~~C~~~I~~~~~g~i~~~~~~fW~qkyCp~H~H~~CF~C~~C~~~l~~~~~f~~~~dG~~yC~~C~~~~v  115 (336)
                      ++...--|+|+.|.+.|.+.-  ++.+.+.          |||..|.+|..|+.+|  +++.+.. +|..||++.|-+  
T Consensus        27 df~~~eip~CagC~q~IlDrF--ilKvl~R----------~wHs~CLkCs~C~~qL--~drCFsR-~~s~yCkedFfK--   89 (383)
T KOG4577|consen   27 DFSNVEIPICAGCDQHILDRF--ILKVLDR----------HWHSSCLKCSDCHDQL--ADRCFSR-EGSVYCKEDFFK--   89 (383)
T ss_pred             cccccccccccchHHHHHHHH--HHHHHhh----------hhhhhhcchhhhhhHH--HHHHhhc-CCceeehHHHHH--
Confidence            344445789999999999863  3334443          6699999999999999  5666665 899999999998  


Q ss_pred             cCCCCCCchhhHH
Q 019777          116 MDTHECQPLYLEI  128 (336)
Q Consensus       116 ~~~~~C~~c~~~I  128 (336)
                      .+..+|.+|..-|
T Consensus        90 rfGTKCsaC~~GI  102 (383)
T KOG4577|consen   90 RFGTKCSACQEGI  102 (383)
T ss_pred             HhCCcchhhcCCC
Confidence            6788899887655


No 16 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=96.95  E-value=0.00035  Score=45.80  Aligned_cols=20  Identities=45%  Similarity=1.411  Sum_probs=18.2

Q ss_pred             CCCcccCCCeeecCCCCCCC
Q 019777            1 MEAFWHPECFRCHSCNLPIT   20 (336)
Q Consensus         1 lg~~wH~~CF~C~~C~~~L~   20 (336)
                      +++.||++||+|..|+++|.
T Consensus        19 ~~~~~H~~Cf~C~~C~~~L~   38 (39)
T smart00132       19 LGKVWHPECFKCSKCGKPLG   38 (39)
T ss_pred             CCccccccCCCCcccCCcCc
Confidence            47899999999999999985


No 17 
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only]
Probab=96.48  E-value=0.00032  Score=64.13  Aligned_cols=99  Identities=19%  Similarity=0.387  Sum_probs=73.5

Q ss_pred             CCcccCCCeeecCCCCCCC--CCceeecCCcccccccccc--ccCCcCcccCCcccCCCCceEEEeeecccccccCCCCc
Q 019777            2 EAFWHPECFRCHSCNLPIT--DVEFSMSGNRPYHKHCYKE--QHHPKCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHE   77 (336)
Q Consensus         2 g~~wH~~CF~C~~C~~~L~--~~~F~~~dg~~yC~~CY~~--~~~pkC~~C~~~I~~~~~g~i~~~~~~fW~qkyCp~H~   77 (336)
                      +..||..|..|..|..++.  ...|.. +|..||..+|..  .+..+|..|...|...+     .....|  ++.     
T Consensus        16 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-~g~~~~~~d~~~~~~~~~rr~rt~~~~~ql~-----~ler~f--~~~-----   82 (235)
T KOG0490|consen   16 DRYWHASCLKCAECDNPLGVGDTCFSK-DGSIYCKRDYQREFKFSKRCARCKFTISQLD-----ELERAF--EKV-----   82 (235)
T ss_pred             cHHHHHHHHhhhhhcchhccCCCcccC-CCcccccccchhhhhccccccCCCCCcCHHH-----HHHHhh--cCC-----
Confidence            4679999999999999998  666666 999999999998  88899999999985432     222222  111     


Q ss_pred             CCCCCccCCCCccCCCCCceEEcCCCceeccchhhh
Q 019777           78 RDGTPRCCSCERMEPRDTKYLSLDDGRKLCLECLDS  113 (336)
Q Consensus        78 H~~CF~C~~C~~~l~~~~~f~~~~dG~~yC~~C~~~  113 (336)
                      |-.||.|..|...+..+..+......+.+|...+..
T Consensus        83 h~Pd~~~r~~la~~~~~~e~rVqvwFqnrrak~r~~  118 (235)
T KOG0490|consen   83 HLPCFACRECLALLLTGDEFRVQVWFQNRRAKDRKE  118 (235)
T ss_pred             CcCccchHHHHhhcCCCCeeeeehhhhhhcHhhhhh
Confidence            778999999998876566665443446666666544


No 18 
>PF13485 Peptidase_MA_2:  Peptidase MA superfamily
Probab=95.65  E-value=0.022  Score=46.06  Aligned_cols=43  Identities=23%  Similarity=0.280  Sum_probs=34.2

Q ss_pred             CCChhhhhhhHHHHHHHHHHHhcC--CCCCCcchhhhHHHHHHHH
Q 019777          220 GLPRLLTGSILAHEMMHAWLRLKG--YPNLRPDVEEGICQVLAHM  262 (336)
Q Consensus       220 glp~~~~~~~lahe~~ha~l~~~g--~~~l~~~veeg~cq~~a~~  262 (336)
                      +-+.-....+|+||+.|+|+....  ...++..+.||+++.++..
T Consensus        19 ~~~~~~~~~~l~HE~~H~~~~~~~~~~~~~~~W~~EG~A~y~~~~   63 (128)
T PF13485_consen   19 GSDEDWLDRVLAHELAHQWFGNYFGGDDNAPRWFNEGLAEYVEGR   63 (128)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHcCCCccCchHHHHHHHHHHhcC
Confidence            444444459999999999988752  3588899999999999965


No 19 
>KOG1702 consensus Nebulin repeat protein [Cytoskeleton]
Probab=94.66  E-value=0.0068  Score=55.32  Aligned_cols=40  Identities=25%  Similarity=0.832  Sum_probs=35.3

Q ss_pred             CCCcccCCCeeecCCCCCCCCCceeecCCccccccccccc
Q 019777            1 MEAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQ   40 (336)
Q Consensus         1 lg~~wH~~CF~C~~C~~~L~~~~F~~~dg~~yC~~CY~~~   40 (336)
                      |++.||..||+|..|+.+|.-..+--.|.+|||...|.+.
T Consensus        23 ldk~whk~cfkce~c~mtlnmKnyKgy~kkpycn~hYpkq   62 (264)
T KOG1702|consen   23 LDKVWHKQCFKCEVCGMTLNMKNYKGYDKKPYCNPHYPKQ   62 (264)
T ss_pred             HHHHHHHHhheeeeccCChhhhhccccccCCCcCcccccc
Confidence            4678999999999999999888887788999999999753


No 20 
>KOG1700 consensus Regulatory protein MLP and related LIM proteins [Signal transduction mechanisms; Cytoskeleton]
Probab=94.41  E-value=0.016  Score=53.01  Aligned_cols=40  Identities=23%  Similarity=0.561  Sum_probs=34.4

Q ss_pred             CCcccCCCeeecCCCCCCCCCceeecCCcccccccccccc
Q 019777            2 EAFWHPECFRCHSCNLPITDVEFSMSGNRPYHKHCYKEQH   41 (336)
Q Consensus         2 g~~wH~~CF~C~~C~~~L~~~~F~~~dg~~yC~~CY~~~~   41 (336)
                      +..||..||+|..|+..|+...+...++.+||+..+.+++
T Consensus       128 ~~~~hk~cfrc~~~~~~ls~~~~~~~~g~l~~~~~~~~~~  167 (200)
T KOG1700|consen  128 GLEFHKSCFRCTHCGKKLSPKNYAALEGVLYCKHHFAQLF  167 (200)
T ss_pred             hhhhhhhheeecccccccCCcchhhcCCccccchhhheee
Confidence            5679999999999999999999999899999877655543


No 21 
>PF04450 BSP:  Peptidase of plants and bacteria;  InterPro: IPR007541 These basic secretory proteins (BSPs) are believed to be part of the plants defence mechanism against pathogens [].
Probab=86.47  E-value=0.63  Score=42.78  Aligned_cols=38  Identities=26%  Similarity=0.300  Sum_probs=31.6

Q ss_pred             hhhhhhHHHHHHHHHHHhcCCCCCCcchhhhHHHHHHHH
Q 019777          224 LLTGSILAHEMMHAWLRLKGYPNLRPDVEEGICQVLAHM  262 (336)
Q Consensus       224 ~~~~~~lahe~~ha~l~~~g~~~l~~~veeg~cq~~a~~  262 (336)
                      --.-.+|-|||+|+|+.- |...-|.-+-|||...+-+.
T Consensus        94 ~Ei~Gvl~HE~~H~~Q~~-~~~~~P~~liEGIADyVRl~  131 (205)
T PF04450_consen   94 DEIIGVLYHEMVHCWQWD-GRGTAPGGLIEGIADYVRLK  131 (205)
T ss_pred             HHHHHHHHHHHHHHhhcC-CCCCCChhheecHHHHHHHH
Confidence            445689999999999987 45578899999999988655


No 22 
>PF14891 Peptidase_M91:  Effector protein
Probab=82.10  E-value=0.9  Score=40.35  Aligned_cols=20  Identities=30%  Similarity=0.441  Sum_probs=17.2

Q ss_pred             hhhhhHHHHHHHHHHHhcCC
Q 019777          225 LTGSILAHEMMHAWLRLKGY  244 (336)
Q Consensus       225 ~~~~~lahe~~ha~l~~~g~  244 (336)
                      .--.+|+|||.|||=.++|-
T Consensus       102 ~p~v~L~HEL~HA~~~~~Gt  121 (174)
T PF14891_consen  102 PPFVVLYHELIHAYDYMNGT  121 (174)
T ss_pred             HHHHHHHHHHHHHHHHHCCC
Confidence            34589999999999999985


No 23 
>PF10026 DUF2268:  Predicted Zn-dependent protease (DUF2268);  InterPro: IPR018728  This domain, found in various hypothetical bacterial proteins, as well as predicted zinc dependent proteases, has no known function. 
Probab=81.37  E-value=2.1  Score=38.74  Aligned_cols=45  Identities=20%  Similarity=0.171  Sum_probs=34.6

Q ss_pred             hhhhhhHHHHHHHHHHHh------cCCCCCCcchhhhHHHHHHHHhhhccc
Q 019777          224 LLTGSILAHEMMHAWLRL------KGYPNLRPDVEEGICQVLAHMWLESEI  268 (336)
Q Consensus       224 ~~~~~~lahe~~ha~l~~------~g~~~l~~~veeg~cq~~a~~wl~~~~  268 (336)
                      -..-+++|||+-|++-.-      .+...|+..|=||+.+..+..-+....
T Consensus        63 ~~l~~~iaHE~hH~~r~~~~~~~~~~~TLld~~I~EGlAe~f~~~~~g~~~  113 (195)
T PF10026_consen   63 EELPALIAHEYHHNCRYEQIGWDPEDTTLLDSLIMEGLAEYFAEELYGEEY  113 (195)
T ss_pred             HHHHHHHHHHHHHHHHHhccCCCCCCCCHHHHHHHhhHHHHHHHHHcCCCC
Confidence            456789999999997433      244567789999999999988766644


No 24 
>PF01433 Peptidase_M1:  Peptidase family M1 This is family M1 in the peptidase classification.;  InterPro: IPR014782 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M1 (clan MA(E)), the type example being aminopeptidase N from Homo sapiens (Human). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA.  Membrane alanine aminopeptidase (3.4.11.2 from EC) is part of the HEXXH+E group; it consists entirely of aminopeptidases, spread across a wide variety of species []. Functional studies show that CD13/APN catalyzes the removal of single amino acids from the amino terminus of small peptides and probably plays a role in their final digestion; one family member (leukotriene-A4 hydrolase) is known to hydrolyse the epoxide leukotriene-A4 to form an inflammatory mediator []. This hydrolase has been shown to have aminopeptidase activity [], and the zinc ligands of the M1 family were identified by site-directed mutagenesis on this enzyme [] CD13 participates in trimming peptides bound to MHC class II molecules [] and cleaves MIP-1 chemokine, which alters target cell specificity from basophils to eosinophils []. CD13 acts as a receptor for specific strains of RNA viruses (coronaviruses) which cause a relatively large percentage of upper respiratory trace infections. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0008237 metallopeptidase activity, 0008270 zinc ion binding; PDB: 2XQ0_A 2XPY_A 2XPZ_A 3SE6_B 3EBH_A 3EBG_A 3T8V_A 3Q44_A 3Q43_A 3EBI_A ....
Probab=81.36  E-value=0.74  Score=45.11  Aligned_cols=43  Identities=26%  Similarity=0.333  Sum_probs=31.7

Q ss_pred             hhhhHHHHHHHHHHHhc-CCCCC-CcchhhhHHHHHHHHhhhccc
Q 019777          226 TGSILAHEMMHAWLRLK-GYPNL-RPDVEEGICQVLAHMWLESEI  268 (336)
Q Consensus       226 ~~~~lahe~~ha~l~~~-g~~~l-~~~veeg~cq~~a~~wl~~~~  268 (336)
                      ...++|||++|-|+--- ....- +..+-||+++.++++|++.-.
T Consensus       295 ~~~~iahElahqWfGn~vt~~~w~d~WL~Eg~a~y~~~~~~~~~~  339 (390)
T PF01433_consen  295 IASLIAHELAHQWFGNLVTPKWWSDLWLNEGFATYLEYLILEKLF  339 (390)
T ss_dssp             HHHHHHHHHHTTTBTTTEEESSGGGHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHhccCCccccchhhhHHHHHHHHHHHHhHhhcc
Confidence            45789999999996421 11111 256999999999999999865


No 25 
>PF01431 Peptidase_M13:  Peptidase family M13 This is family M13 in the peptidase classification. ;  InterPro: IPR018497 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M13 (neprilysin family, clan MA(E)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. M13 peptidases are well-studied proteases found in a wide range of organisms including mammals and bacteria. In mammals they participate in processes such as cardiovascular development, blood-pressure regulation, nervous control of respiration, and regulation of the function of neuropeptides in the central nervous system. In bacteria they may be used for digestion of milk [, ]. The family includes eukaryotic and prokaryotic oligopeptidases, as well as some of the proteins responsible for the molecular basis of the blood group antigens e.g. Kell [].  Neprilysin (3.4.24.11 from EC), is another member of this group, it is variously known as common acute lymphoblastic leukemia antigen (CALLA), enkephalinase (gp100) and neutral endopeptidase metalloendopeptidase (NEP). It is a plasma membrane-bound mammalian enzyme that is able to digest biologically-active peptides, including enkephalins []. The zinc ligands of neprilysin are known and are analogous to those in thermolysin, a related peptidase [, ]. Neprilysins, like thermolysin, are inhibited by phosphoramidon, which appears to selectively inhibit this family in mammals. The enzymes are all oligopeptidases, digesting oligo- and polypeptides, but not proteins []. Neprilysin consists of a short cytoplasmic domain, a membrane-spanning region and a large extracellular domain. The cytoplasmic domain contains a conformationally-restrained octapeptide, which is thought to act as a stop transfer sequence that prevents proteolysis and secretion [, ].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2QPJ_A 1R1I_A 1R1J_A 1Y8J_A 1R1H_A 1DMT_A 2YB9_A 3DWB_A 3ZUK_A.
Probab=79.66  E-value=0.68  Score=41.68  Aligned_cols=17  Identities=53%  Similarity=0.579  Sum_probs=14.5

Q ss_pred             hhhhhHHHHHHHHHHHh
Q 019777          225 LTGSILAHEMMHAWLRL  241 (336)
Q Consensus       225 ~~~~~lahe~~ha~l~~  241 (336)
                      ..|+||||||+||+-..
T Consensus        35 ~lG~ilahel~hafd~~   51 (206)
T PF01431_consen   35 GLGFILAHELMHAFDPE   51 (206)
T ss_dssp             THHHHHHHHHHHCTSTT
T ss_pred             HHHHHHHHHHHHHHHHh
Confidence            47999999999999654


No 26 
>PF06114 DUF955:  Domain of unknown function (DUF955);  InterPro: IPR010359 This is a family of bacterial and viral proteins with undetermined function. A conserved H-E-X-X-H motif is suggestive of a catalytic active site and shows similarity to IPR001915 from INTERPRO.; PDB: 3DTE_A 3DTK_A 3DTI_A.
Probab=78.34  E-value=2.4  Score=33.59  Aligned_cols=52  Identities=23%  Similarity=0.150  Sum_probs=34.2

Q ss_pred             EEEEEecCCChhhhhhhHHHHHHHHHHHhcCC------CCCCcchhhhHHHHHHHHhh
Q 019777          213 TAILILYGLPRLLTGSILAHEMMHAWLRLKGY------PNLRPDVEEGICQVLAHMWL  264 (336)
Q Consensus       213 ~~ilvl~glp~~~~~~~lahe~~ha~l~~~g~------~~l~~~veeg~cq~~a~~wl  264 (336)
                      .-|+|=..++..-.-.++|||++|.++.-.+.      ........|=-++..|...|
T Consensus        29 ~~I~in~~~~~~~~~f~laHELgH~~~~~~~~~~~~~~~~~~~~~~E~~An~fA~~lL   86 (122)
T PF06114_consen   29 PIIFINSNLSPERQRFTLAHELGHILLHHGDETFNYYLNYFFNERQEREANAFAAALL   86 (122)
T ss_dssp             TEEEEESSS-HHHHHHHHHHHHHHHHHHH-HHHHHHHHHH--THHHHHHHHHHHHHHH
T ss_pred             CEEEECCCCCHHHHHHHHHHHHHHHHhhhccccchhhccccchhhHHHHHHHHHHHHh
Confidence            45778888999999999999999999988641      23344445555555554443


No 27 
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=77.22  E-value=1.5  Score=37.64  Aligned_cols=22  Identities=32%  Similarity=0.150  Sum_probs=19.6

Q ss_pred             CChhhhhhhHHHHHHHHHHHhc
Q 019777          221 LPRLLTGSILAHEMMHAWLRLK  242 (336)
Q Consensus       221 lp~~~~~~~lahe~~ha~l~~~  242 (336)
                      .|.-..-.+|+|||.|||+.+.
T Consensus        55 ~~~~~~~~tL~HEm~H~~~~~~   76 (157)
T PF10263_consen   55 NPEEELIDTLLHEMAHAAAYVF   76 (157)
T ss_pred             hHHHHHHHHHHHHHHHHHhhhc
Confidence            5677888999999999999887


No 28 
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=74.39  E-value=1.1  Score=40.36  Aligned_cols=49  Identities=18%  Similarity=0.497  Sum_probs=38.8

Q ss_pred             CCCeeecCCCCCCCCCc-eeecCCccccccccccc--cCCcCcccCCcccCC
Q 019777            7 PECFRCHSCNLPITDVE-FSMSGNRPYHKHCYKEQ--HHPKCDVCQNFIPTN   55 (336)
Q Consensus         7 ~~CF~C~~C~~~L~~~~-F~~~dg~~yC~~CY~~~--~~pkC~~C~~~I~~~   55 (336)
                      ..||+|..|=....... +..+=|.+||+.|-++.  ...+|..|++.|...
T Consensus       129 ~~~~~CPiCl~~~sek~~vsTkCGHvFC~~Cik~alk~~~~CP~C~kkIt~k  180 (187)
T KOG0320|consen  129 EGTYKCPICLDSVSEKVPVSTKCGHVFCSQCIKDALKNTNKCPTCRKKITHK  180 (187)
T ss_pred             ccccCCCceecchhhccccccccchhHHHHHHHHHHHhCCCCCCcccccchh
Confidence            35889999977766544 66788999999999863  567999999988754


No 29 
>PF13699 DUF4157:  Domain of unknown function (DUF4157)
Probab=73.98  E-value=2  Score=33.39  Aligned_cols=18  Identities=33%  Similarity=0.564  Sum_probs=14.3

Q ss_pred             hhhhHHHHHHHHHHHhcC
Q 019777          226 TGSILAHEMMHAWLRLKG  243 (336)
Q Consensus       226 ~~~~lahe~~ha~l~~~g  243 (336)
                      .-.+||||++|++..-.|
T Consensus        61 ~~~llaHEl~Hv~Qq~~g   78 (79)
T PF13699_consen   61 GRALLAHELAHVVQQRRG   78 (79)
T ss_pred             cchhHhHHHHHHHhhccC
Confidence            457999999999876543


No 30 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=73.32  E-value=3.4  Score=31.15  Aligned_cols=47  Identities=15%  Similarity=0.318  Sum_probs=24.8

Q ss_pred             eeecCCCCCCCCCceeecCCccccccccccccCCcCcccCCcccCCC
Q 019777           10 FRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNFIPTNS   56 (336)
Q Consensus        10 F~C~~C~~~L~~~~F~~~dg~~yC~~CY~~~~~pkC~~C~~~I~~~~   56 (336)
                      ++|..|..-|...-....=...||..|-.+.++..|.+|+.|-..++
T Consensus         8 LrCs~C~~~l~~pv~l~~CeH~fCs~Ci~~~~~~~CPvC~~Paw~qD   54 (65)
T PF14835_consen    8 LRCSICFDILKEPVCLGGCEHIFCSSCIRDCIGSECPVCHTPAWIQD   54 (65)
T ss_dssp             TS-SSS-S--SS-B---SSS--B-TTTGGGGTTTB-SSS--B-S-SS
T ss_pred             cCCcHHHHHhcCCceeccCccHHHHHHhHHhcCCCCCCcCChHHHHH
Confidence            47888988776532333456899999999989999999999987654


No 31 
>PF10460 Peptidase_M30:  Peptidase M30;  InterPro: IPR019501 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases [].  This family contains metallopeptidases belonging to MEROPS peptidase family M30 (hyicolysin family, clan MA). Hyicolysin has a zinc ion which is liganded by two histidine and one glutamate residue. 
Probab=71.84  E-value=4.5  Score=40.44  Aligned_cols=41  Identities=24%  Similarity=0.250  Sum_probs=30.7

Q ss_pred             hhhhhHHHHHHHHH---HH--hcCC-CCCCcchhhhHHHHHHHHhhh
Q 019777          225 LTGSILAHEMMHAW---LR--LKGY-PNLRPDVEEGICQVLAHMWLE  265 (336)
Q Consensus       225 ~~~~~lahe~~ha~---l~--~~g~-~~l~~~veeg~cq~~a~~wl~  265 (336)
                      .+-++||||++|.=   .|  +.|- ..-+..+|||+-+++.++--.
T Consensus       138 ~~~sTlAHEfQHmInfy~~~v~~g~~~~~dtWLnE~lS~~aEdl~s~  184 (366)
T PF10460_consen  138 TVYSTLAHEFQHMINFYQRGVLHGKQYAMDTWLNEMLSMSAEDLYSS  184 (366)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcCCCcccccHHHHHHHHHHHHHHhc
Confidence            46799999999964   33  2342 357899999999999887533


No 32 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=71.66  E-value=2.8  Score=33.38  Aligned_cols=29  Identities=24%  Similarity=0.617  Sum_probs=23.5

Q ss_pred             eecCCCCCCCCCceee-cCCcccccccccc
Q 019777           11 RCHSCNLPITDVEFSM-SGNRPYHKHCYKE   39 (336)
Q Consensus        11 ~C~~C~~~L~~~~F~~-~dg~~yC~~CY~~   39 (336)
                      .|..|+++|....|.. .+|..+|..|..+
T Consensus        80 ~C~vC~k~l~~~~f~~~p~~~v~H~~C~~r  109 (109)
T PF10367_consen   80 KCSVCGKPLGNSVFVVFPCGHVVHYSCIKR  109 (109)
T ss_pred             CccCcCCcCCCceEEEeCCCeEEecccccC
Confidence            5899999999877776 5678899888753


No 33 
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=71.21  E-value=1.1  Score=30.03  Aligned_cols=33  Identities=18%  Similarity=0.361  Sum_probs=22.5

Q ss_pred             CcccCCcccCCCCceEEEeeecccccccCCCCcCCCCCccCCCCccC
Q 019777           45 CDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCERME   91 (336)
Q Consensus        45 C~~C~~~I~~~~~g~i~~~~~~fW~qkyCp~H~H~~CF~C~~C~~~l   91 (336)
                      |+.|+++|.+++ -++.+.++.|          +   |.|.+|.+.|
T Consensus         1 Cd~CG~~I~~eP-~~~k~~~~~y----------~---fCC~tC~~~f   33 (37)
T PF08394_consen    1 CDYCGGEITGEP-IVVKIGNKVY----------Y---FCCPTCLSQF   33 (37)
T ss_pred             CCccCCcccCCE-EEEEECCeEE----------E---EECHHHHHHH
Confidence            788999999875 2334455554          2   7778887665


No 34 
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=70.06  E-value=3.3  Score=35.64  Aligned_cols=23  Identities=39%  Similarity=0.288  Sum_probs=18.2

Q ss_pred             CChhhhhhhHHHHHHHHHHHhcC
Q 019777          221 LPRLLTGSILAHEMMHAWLRLKG  243 (336)
Q Consensus       221 lp~~~~~~~lahe~~ha~l~~~g  243 (336)
                      .|...+-.+|.|||.|++..+.|
T Consensus        54 ~~~~~l~~~l~HEm~H~~~~~~g   76 (146)
T smart00731       54 NGRDRLRETLLHELCHAALYLFG   76 (146)
T ss_pred             ccHHHHHhhHHHHHHHHHHHHhC
Confidence            34556677999999999998754


No 35 
>KOG1702 consensus Nebulin repeat protein [Cytoskeleton]
Probab=69.30  E-value=0.59  Score=42.94  Aligned_cols=58  Identities=12%  Similarity=0.244  Sum_probs=39.5

Q ss_pred             CcCcccCCcccCCCCceEEEeeecccccccCCCCcCCCCCccCCCCccCCCCCceEEcCCCceeccchhhhc
Q 019777           43 PKCDVCQNFIPTNSAGLIEYRAHPFWLQKYCPSHERDGTPRCCSCERMEPRDTKYLSLDDGRKLCLECLDSA  114 (336)
Q Consensus        43 pkC~~C~~~I~~~~~g~i~~~~~~fW~qkyCp~H~H~~CF~C~~C~~~l~~~~~f~~~~dG~~yC~~C~~~~  114 (336)
                      +.|..|++.+.+-+  .+.-.++ +|         |..||+|..|+..|. -.+|-.. |.++||-..|.+.
T Consensus         5 ~n~~~cgk~vYPvE--~v~cldk-~w---------hk~cfkce~c~mtln-mKnyKgy-~kkpycn~hYpkq   62 (264)
T KOG1702|consen    5 CNREDCGKTVYPVE--EVKCLDK-VW---------HKQCFKCEVCGMTLN-MKNYKGY-DKKPYCNPHYPKQ   62 (264)
T ss_pred             chhhhhccccccHH--HHhhHHH-HH---------HHHhheeeeccCChh-hhhcccc-ccCCCcCcccccc
Confidence            45667777665432  2333343 35         999999999999885 3444333 7899999998764


No 36 
>TIGR02412 pepN_strep_liv aminopeptidase N, Streptomyces lividans type. This family is a subset of the members of the zinc metallopeptidase family M1 (pfam01433), with a single member characterized in Streptomyces lividans 66 and designated aminopeptidase N. The spectrum of activity may differ somewhat from the aminopeptidase N clade of E. coli and most other Proteobacteria, well separated phylogenetically within the M1 family. The M1 family also includes leukotriene A-4 hydrolase/aminopeptidase (with a bifunctional active site).
Probab=69.21  E-value=4.7  Score=44.40  Aligned_cols=40  Identities=18%  Similarity=0.286  Sum_probs=29.9

Q ss_pred             hhhHHHHHHHHHHH-hcCCC-CCCcchhhhHHHHHHHHhhhc
Q 019777          227 GSILAHEMMHAWLR-LKGYP-NLRPDVEEGICQVLAHMWLES  266 (336)
Q Consensus       227 ~~~lahe~~ha~l~-~~g~~-~l~~~veeg~cq~~a~~wl~~  266 (336)
                      ..++|||++|-|.- |-... -=+..+-||+...++++|++.
T Consensus       288 ~~viaHElAHqWFGnlVT~~wW~dlWLnEGFAty~e~~~~~~  329 (831)
T TIGR02412       288 AGVILHEMAHMWFGDLVTMRWWNDLWLNESFAEYMGTLASAE  329 (831)
T ss_pred             HHHHHHHHHHHHhCCEeccccccchhHHHHHHHHHHHHHHHh
Confidence            47999999999974 11111 123678999999999999875


No 37 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=66.80  E-value=5.8  Score=42.61  Aligned_cols=38  Identities=21%  Similarity=0.603  Sum_probs=28.4

Q ss_pred             eecCCCCCCCCCceeecCCccccccccccccCCcCcccCCcccCC
Q 019777           11 RCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNFIPTN   55 (336)
Q Consensus        11 ~C~~C~~~L~~~~F~~~dg~~yC~~CY~~~~~pkC~~C~~~I~~~   55 (336)
                      +|..|+....       ++..||..|-..+....|..|+..+...
T Consensus         3 ~Cp~Cg~~n~-------~~akFC~~CG~~l~~~~Cp~CG~~~~~~   40 (645)
T PRK14559          3 ICPQCQFENP-------NNNRFCQKCGTSLTHKPCPQCGTEVPVD   40 (645)
T ss_pred             cCCCCCCcCC-------CCCccccccCCCCCCCcCCCCCCCCCcc
Confidence            6888887753       3455788888776667899999987754


No 38 
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=65.39  E-value=3.7  Score=31.47  Aligned_cols=57  Identities=16%  Similarity=0.359  Sum_probs=32.2

Q ss_pred             eecCCCCCCCCCceeecCCccccccccccc-cCCcCcccCCcccCCCCceEEEee-ecccccccCCCCcCCCCCccCCCC
Q 019777           11 RCHSCNLPITDVEFSMSGNRPYHKHCYKEQ-HHPKCDVCQNFIPTNSAGLIEYRA-HPFWLQKYCPSHERDGTPRCCSCE   88 (336)
Q Consensus        11 ~C~~C~~~L~~~~F~~~dg~~yC~~CY~~~-~~pkC~~C~~~I~~~~~g~i~~~~-~~fW~qkyCp~H~H~~CF~C~~C~   88 (336)
                      .|..|+.+|...     ++..+|..|.... ..+.|..|++++.     ++.+=| ..               |.|..|+
T Consensus         3 ~CP~C~~~L~~~-----~~~~~C~~C~~~~~~~a~CPdC~~~Le-----~LkACGAvd---------------YFC~~c~   57 (70)
T PF07191_consen    3 TCPKCQQELEWQ-----GGHYHCEACQKDYKKEAFCPDCGQPLE-----VLKACGAVD---------------YFCNHCH   57 (70)
T ss_dssp             B-SSS-SBEEEE-----TTEEEETTT--EEEEEEE-TTT-SB-E-----EEEETTEEE---------------EE-TTTT
T ss_pred             cCCCCCCccEEe-----CCEEECccccccceecccCCCcccHHH-----HHHHhcccc---------------eeeccCC
Confidence            588898888653     3778888887652 3468999999987     466655 33               3588888


Q ss_pred             ccCC
Q 019777           89 RMEP   92 (336)
Q Consensus        89 ~~l~   92 (336)
                      .++.
T Consensus        58 gLiS   61 (70)
T PF07191_consen   58 GLIS   61 (70)
T ss_dssp             -EE-
T ss_pred             ceee
Confidence            7664


No 39 
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=63.27  E-value=3.9  Score=39.57  Aligned_cols=45  Identities=18%  Similarity=0.364  Sum_probs=34.8

Q ss_pred             eeecCCCCCCCCCceeecCCcccccccccccc--CCcCcccCCcccCC
Q 019777           10 FRCHSCNLPITDVEFSMSGNRPYHKHCYKEQH--HPKCDVCQNFIPTN   55 (336)
Q Consensus        10 F~C~~C~~~L~~~~F~~~dg~~yC~~CY~~~~--~pkC~~C~~~I~~~   55 (336)
                      |.|..|++++.. .-...-+..||+.|..+.+  +++|.+|++.+.+.
T Consensus       242 f~c~icr~~f~~-pVvt~c~h~fc~~ca~~~~qk~~~c~vC~~~t~g~  288 (313)
T KOG1813|consen  242 FKCFICRKYFYR-PVVTKCGHYFCEVCALKPYQKGEKCYVCSQQTHGS  288 (313)
T ss_pred             cccccccccccc-chhhcCCceeehhhhccccccCCcceecccccccc
Confidence            778888888765 3444667899999997755  47999999998874


No 40 
>PF09768 Peptidase_M76:  Peptidase M76 family;  InterPro: IPR019165 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. Mitochondrial inner membrane protease ATP23 has two roles in the assembly of mitochondrial ATPase. Firstly, it acts as a protease that removes the N-terminal 10 residues of mitochondrial ATPase CF(0) subunit 6 (ATP6) at the intermembrane space side. Secondly, it is involved in the correct assembly of the membrane-embedded ATPase CF(0) particle, probably mediating association of ATP6 with the subunit 9 ring [, ].; GO: 0004222 metalloendopeptidase activity
Probab=61.75  E-value=4.5  Score=36.28  Aligned_cols=19  Identities=26%  Similarity=0.354  Sum_probs=14.7

Q ss_pred             hhhhhhhHHHHHHHHHHHh
Q 019777          223 RLLTGSILAHEMMHAWLRL  241 (336)
Q Consensus       223 ~~~~~~~lahe~~ha~l~~  241 (336)
                      +....-+|+|||.|||=.+
T Consensus        68 ~~~l~~~l~HELIHayD~c   86 (173)
T PF09768_consen   68 QGHLEDTLTHELIHAYDHC   86 (173)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            3445689999999999544


No 41 
>PF01447 Peptidase_M4:  Thermolysin metallopeptidase, catalytic domain This Prosite motif covers only the active site. This is family M4 in the peptidase classification. ;  InterPro: IPR013856 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases that belong to the MEROPS peptidase family M4 (thermolysin family, clan MA(E)). The protein fold of the peptidase domain of thermolysin, is the type example for members of the clan MA. The thermolysin family is composed only of secreted eubacterial endopeptidases. The zinc-binding residues are H-142, H-146 and E-166, with E-143 acting as the catalytic residue. Thermolysin also contains 4 calcium-binding sites, which contribute to its unusual thermostability. The family also includes enzymes from a number of pathogens, including Legionella and Listeria, and the protein pseudolysin, all with a substrate specificity for an aromatic residue in the P1' position. Three-dimensional structure analysis has shown that the enzymes undergo a hinge-bend motion during catalysis. Pseudolysin has a broader specificity, acting on large molecules such as elastin and collagen, possibly due to its wider active site cleft []. This entry represents a domain found in peptidase M4 family members.; GO: 0004222 metalloendopeptidase activity; PDB: 3NQX_A 3NQZ_B 3NQY_B 1BQB_A 1U4G_A 1EZM_A 3DBK_A 1ESP_A 1NPC_A 1LND_E ....
Probab=61.67  E-value=4.9  Score=35.12  Aligned_cols=18  Identities=28%  Similarity=0.379  Sum_probs=12.3

Q ss_pred             ChhhhhhhHHHHHHHHHH
Q 019777          222 PRLLTGSILAHEMMHAWL  239 (336)
Q Consensus       222 p~~~~~~~lahe~~ha~l  239 (336)
                      |....-=|+||||+|+..
T Consensus       131 ~~~~~lDVvaHEltHGVt  148 (150)
T PF01447_consen  131 PFASSLDVVAHELTHGVT  148 (150)
T ss_dssp             -GGG-HHHHHHHHHHHHH
T ss_pred             cCccccceeeeccccccc
Confidence            333335799999999864


No 42 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=60.31  E-value=5.6  Score=28.54  Aligned_cols=45  Identities=13%  Similarity=0.214  Sum_probs=34.6

Q ss_pred             eeecCCCCCCCCCceeecCCcccccccccccc--CCcCcccCCcccCC
Q 019777           10 FRCHSCNLPITDVEFSMSGNRPYHKHCYKEQH--HPKCDVCQNFIPTN   55 (336)
Q Consensus        10 F~C~~C~~~L~~~~F~~~dg~~yC~~CY~~~~--~pkC~~C~~~I~~~   55 (336)
                      |.|..|+..+.+ ......|..||+.|..+..  ...|..|++++...
T Consensus         2 ~~Cpi~~~~~~~-Pv~~~~G~v~~~~~i~~~~~~~~~cP~~~~~~~~~   48 (63)
T smart00504        2 FLCPISLEVMKD-PVILPSGQTYERRAIEKWLLSHGTDPVTGQPLTHE   48 (63)
T ss_pred             cCCcCCCCcCCC-CEECCCCCEEeHHHHHHHHHHCCCCCCCcCCCChh
Confidence            678999999876 3455678999999987532  46799999988654


No 43 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=60.00  E-value=5.5  Score=29.49  Aligned_cols=37  Identities=22%  Similarity=0.499  Sum_probs=19.1

Q ss_pred             eecCCCCCCCCCceeecCCccccccccccccCCcCcccCCc
Q 019777           11 RCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNF   51 (336)
Q Consensus        11 ~C~~C~~~L~~~~F~~~dg~~yC~~CY~~~~~pkC~~C~~~   51 (336)
                      +|..|+.+|...+-+   -...|..|-+. .-.||..|.+.
T Consensus         9 ~CtSCg~~i~~~~~~---~~F~CPnCG~~-~I~RC~~CRk~   45 (59)
T PRK14890          9 KCTSCGIEIAPREKA---VKFLCPNCGEV-IIYRCEKCRKQ   45 (59)
T ss_pred             cccCCCCcccCCCcc---CEeeCCCCCCe-eEeechhHHhc
Confidence            567777777654311   13456666432 23345555553


No 44 
>COG2856 Predicted Zn peptidase [Amino acid transport and metabolism]
Probab=59.86  E-value=16  Score=33.81  Aligned_cols=55  Identities=25%  Similarity=0.131  Sum_probs=39.9

Q ss_pred             EEEEEecCCChhhhhhhHHHHHHHHHHHhcC------CCC-CCcchhhhHHHHHHHHhhhcc
Q 019777          213 TAILILYGLPRLLTGSILAHEMMHAWLRLKG------YPN-LRPDVEEGICQVLAHMWLESE  267 (336)
Q Consensus       213 ~~ilvl~glp~~~~~~~lahe~~ha~l~~~g------~~~-l~~~veeg~cq~~a~~wl~~~  267 (336)
                      .-|++-.-.+...-.=+||||+.|++|--.+      .++ -....-|--|+.+|-.-|-..
T Consensus        59 ~~I~iN~n~~~~r~rFtlAHELGH~llH~~~~~~~~~~~~~~~~~~~E~~AN~FAa~lLmP~  120 (213)
T COG2856          59 PVIYINANNSLERKRFTLAHELGHALLHTDLNTRFDAEPTLQQDRKIEAEANAFAAELLMPE  120 (213)
T ss_pred             ceEEEeCCCCHHHHHHHHHHHHhHHHhccccchhhhcccccchhHHHHHHHHHHHHHHhCCh
Confidence            4566666678888888999999999987654      122 224456778999988877654


No 45 
>PRK04351 hypothetical protein; Provisional
Probab=59.59  E-value=6.8  Score=34.23  Aligned_cols=22  Identities=32%  Similarity=0.342  Sum_probs=17.5

Q ss_pred             ChhhhhhhHHHHHHHHHHHhcC
Q 019777          222 PRLLTGSILAHEMMHAWLRLKG  243 (336)
Q Consensus       222 p~~~~~~~lahe~~ha~l~~~g  243 (336)
                      +.-.+..||+|||.|..+.+.|
T Consensus        57 ~~~~l~~vv~HElcH~~~~~~g   78 (149)
T PRK04351         57 GLEELIGIIKHELCHYHLHLEG   78 (149)
T ss_pred             cHHHHHhhHHHHHHHHHHHHHC
Confidence            3445578999999999998864


No 46 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=59.34  E-value=5.1  Score=34.37  Aligned_cols=23  Identities=22%  Similarity=0.648  Sum_probs=18.1

Q ss_pred             eecCCCCCCCCCceeecCCccccccccc
Q 019777           11 RCHSCNLPITDVEFSMSGNRPYHKHCYK   38 (336)
Q Consensus        11 ~C~~C~~~L~~~~F~~~dg~~yC~~CY~   38 (336)
                      .|..|+.||    |- ++|.+||.-|-.
T Consensus        30 hCp~Cg~PL----F~-KdG~v~CPvC~~   52 (131)
T COG1645          30 HCPKCGTPL----FR-KDGEVFCPVCGY   52 (131)
T ss_pred             hCcccCCcc----ee-eCCeEECCCCCc
Confidence            378899988    44 899999888764


No 47 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=58.99  E-value=5.2  Score=27.83  Aligned_cols=43  Identities=21%  Similarity=0.499  Sum_probs=30.5

Q ss_pred             eecCCCCCCCCCceeecCCcc-ccccccccc--cCCcCcccCCcccC
Q 019777           11 RCHSCNLPITDVEFSMSGNRP-YHKHCYKEQ--HHPKCDVCQNFIPT   54 (336)
Q Consensus        11 ~C~~C~~~L~~~~F~~~dg~~-yC~~CY~~~--~~pkC~~C~~~I~~   54 (336)
                      .|..|.....+. .+..=|.. +|..|..+.  ...+|..|+++|..
T Consensus         4 ~C~iC~~~~~~~-~~~pCgH~~~C~~C~~~~~~~~~~CP~Cr~~i~~   49 (50)
T PF13920_consen    4 ECPICFENPRDV-VLLPCGHLCFCEECAERLLKRKKKCPICRQPIES   49 (50)
T ss_dssp             B-TTTSSSBSSE-EEETTCEEEEEHHHHHHHHHTTSBBTTTTBB-SE
T ss_pred             CCccCCccCCce-EEeCCCChHHHHHHhHHhcccCCCCCcCChhhcC
Confidence            577777776553 33455777 999999876  56899999999863


No 48 
>PF12773 DZR:  Double zinc ribbon
Probab=58.80  E-value=9.3  Score=26.47  Aligned_cols=11  Identities=27%  Similarity=0.773  Sum_probs=5.1

Q ss_pred             ceeccchhhhc
Q 019777          104 RKLCLECLDSA  114 (336)
Q Consensus       104 ~~yC~~C~~~~  114 (336)
                      ..+|..|...+
T Consensus        29 ~~~C~~Cg~~~   39 (50)
T PF12773_consen   29 KKICPNCGAEN   39 (50)
T ss_pred             CCCCcCCcCCC
Confidence            34455554443


No 49 
>cd04270 ZnMc_TACE_like Zinc-dependent metalloprotease; TACE_like subfamily. TACE, the tumor-necrosis factor-alpha converting enzyme, releases soluble TNF-alpha from transmembrane pro-TNF-alpha.
Probab=58.10  E-value=5.7  Score=37.23  Aligned_cols=18  Identities=28%  Similarity=0.486  Sum_probs=15.7

Q ss_pred             CChhhhhhhHHHHHHHHH
Q 019777          221 LPRLLTGSILAHEMMHAW  238 (336)
Q Consensus       221 lp~~~~~~~lahe~~ha~  238 (336)
                      +|...+..++||||+|.+
T Consensus       162 ~~~~~~a~t~AHElGHnl  179 (244)
T cd04270         162 VPTKESDLVTAHELGHNF  179 (244)
T ss_pred             cchhHHHHHHHHHHHHhc
Confidence            577778899999999987


No 50 
>PF01435 Peptidase_M48:  Peptidase family M48 This is family M48 in the peptidase classification. ;  InterPro: IPR001915 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M48 (Ste24 endopeptidase family, clan M-); members of both subfamily are represented. The members of this set of proteins are mostly described as probable protease htpX homologue (3.4.24 from EC) or CAAX prenyl protease 1, which proteolytically removes the C-terminal three residues of farnesylated proteins. They are integral membrane proteins associated with the endoplasmic reticulum and Golgi, binding one zinc ion per subunit. In Saccharomyces cerevisiae (Baker's yeast) Ste24p is required for the first NH2-terminal proteolytic processing event within the a-factor precursor, which takes place after COOH-terminal CAAX modification is complete. The Ste24p contains multiple predicted membrane spans, a zinc metalloprotease motif (HEXXH), and a COOH-terminal ER retrieval signal (KKXX). The HEXXH protease motif is critical for Ste24p activity, since Ste24p fails to function when conserved residues within this motif are mutated.  The Ste24p homologues occur in a diverse group of organisms, including Escherichia coli, Schizosaccharomyces pombe (Fission yeast), Haemophilus influenzae, and Homo sapiens (Human), which indicates that the gene is highly conserved throughout evolution. Ste24p and the proteins related to it define a subfamily of proteins that are likely to function as intracellular, membrane-associated zinc metalloproteases [].  HtpX is a zinc-dependent endoprotease member of the membrane-localized proteolytic system in E. coli, which participates in the proteolytic quality control of membrane proteins in conjunction with FtsH, a membrane-bound and ATP-dependent protease. Biochemical characterisation revealed that HtpX undergoes self-degradation upon cell disruption or membrane solubilization. It can also degraded casein and cleaves solubilized membrane proteins, for example, SecY []. Expression of HtpX in the plasma membrane is under the control of CpxR, with the metalloproteinase active site of HtpX located on the cytosolic side of the membrane. This suggests a potential role for HtpX in the response to mis-folded proteins [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis, 0016020 membrane; PDB: 3CQB_A 3C37_B.
Probab=57.97  E-value=8.2  Score=34.56  Aligned_cols=29  Identities=31%  Similarity=0.334  Sum_probs=21.5

Q ss_pred             EEEEecC----CChhhhhhhHHHHHHHHHHHhc
Q 019777          214 AILILYG----LPRLLTGSILAHEMMHAWLRLK  242 (336)
Q Consensus       214 ~ilvl~g----lp~~~~~~~lahe~~ha~l~~~  242 (336)
                      .|+|-.|    +++--..+|||||++|...+-.
T Consensus        73 ~I~v~~~ll~~~~~~el~aVlaHElgH~~~~h~  105 (226)
T PF01435_consen   73 RIVVTSGLLESLSEDELAAVLAHELGHIKHRHI  105 (226)
T ss_dssp             EEEEEHHHHHHSSHHHHHHHHHHHHHHHHTTHC
T ss_pred             EEEEeChhhhcccHHHHHHHHHHHHHHHHcCCc
Confidence            4555555    5666677999999999997763


No 51 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=57.05  E-value=8.9  Score=30.38  Aligned_cols=27  Identities=15%  Similarity=0.540  Sum_probs=16.0

Q ss_pred             cCCCCccCCCCCceEEcCCCceeccchh
Q 019777           84 CCSCERMEPRDTKYLSLDDGRKLCLECL  111 (336)
Q Consensus        84 C~~C~~~l~~~~~f~~~~dG~~yC~~C~  111 (336)
                      |..|+++|. +..|+..++|..+...|.
T Consensus        81 C~vC~k~l~-~~~f~~~p~~~v~H~~C~  107 (109)
T PF10367_consen   81 CSVCGKPLG-NSVFVVFPCGHVVHYSCI  107 (109)
T ss_pred             ccCcCCcCC-CceEEEeCCCeEEecccc
Confidence            666666664 455666666666655554


No 52 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=57.01  E-value=3.4  Score=29.56  Aligned_cols=29  Identities=24%  Similarity=0.507  Sum_probs=23.1

Q ss_pred             eecCCCCCCCCCc-eeecCCccccccccccc
Q 019777           11 RCHSCNLPITDVE-FSMSGNRPYHKHCYKEQ   40 (336)
Q Consensus        11 ~C~~C~~~L~~~~-F~~~dg~~yC~~CY~~~   40 (336)
                      .|+.|+..+.-.. |-..|| ..|.+|+.++
T Consensus         1 ~C~iCg~kigl~~~~k~~DG-~iC~~C~~Kl   30 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDG-YICKDCLKKL   30 (51)
T ss_pred             CCCccccccccccceeccCc-cchHHHHHHh
Confidence            4899999997533 667888 7999999875


No 53 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=56.02  E-value=7.4  Score=26.64  Aligned_cols=22  Identities=23%  Similarity=0.690  Sum_probs=15.9

Q ss_pred             eecCCCCCCCCCceeecCCccccccc
Q 019777           11 RCHSCNLPITDVEFSMSGNRPYHKHC   36 (336)
Q Consensus        11 ~C~~C~~~L~~~~F~~~dg~~yC~~C   36 (336)
                      .|..|+.||-    -.++|+.||..|
T Consensus        19 ~Cp~C~~PL~----~~k~g~~~Cv~C   40 (41)
T PF06677_consen   19 HCPDCGTPLM----RDKDGKIYCVSC   40 (41)
T ss_pred             ccCCCCCeeE----EecCCCEECCCC
Confidence            4677887773    347888888776


No 54 
>PHA02456 zinc metallopeptidase motif-containing protein
Probab=53.85  E-value=7.8  Score=32.47  Aligned_cols=17  Identities=47%  Similarity=0.761  Sum_probs=13.1

Q ss_pred             hhHHHHHHHHHHHhc-CC
Q 019777          228 SILAHEMMHAWLRLK-GY  244 (336)
Q Consensus       228 ~~lahe~~ha~l~~~-g~  244 (336)
                      -.||||+.|+|..-. |+
T Consensus        81 ~TL~HEL~H~WQ~RsYG~   98 (141)
T PHA02456         81 DTLAHELNHAWQFRTYGL   98 (141)
T ss_pred             HHHHHHHHHHHhhhccce
Confidence            579999999996543 54


No 55 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=53.17  E-value=8.1  Score=28.14  Aligned_cols=39  Identities=23%  Similarity=0.629  Sum_probs=23.0

Q ss_pred             eecCCCCCCCCC-ce--eecCCccccccccccccCCcCcc--cCCc
Q 019777           11 RCHSCNLPITDV-EF--SMSGNRPYHKHCYKEQHHPKCDV--CQNF   51 (336)
Q Consensus        11 ~C~~C~~~L~~~-~F--~~~dg~~yC~~CY~~~~~pkC~~--C~~~   51 (336)
                      +|..|+++|.+. .-  -..=|-||+++||.+  .-.|..  |+.+
T Consensus         7 ~C~~Cg~~~~~~dDiVvCp~CgapyHR~C~~~--~g~C~~~~c~~~   50 (54)
T PF14446_consen    7 KCPVCGKKFKDGDDIVVCPECGAPYHRDCWEK--AGGCINYSCGTG   50 (54)
T ss_pred             cChhhCCcccCCCCEEECCCCCCcccHHHHhh--CCceEeccCCCC
Confidence            578888888421 12  223477888888864  334544  4443


No 56 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=52.92  E-value=7.4  Score=26.41  Aligned_cols=39  Identities=21%  Similarity=0.524  Sum_probs=27.7

Q ss_pred             ecCCCCCCC-CCcee-ecCCcccccccccccc--CCcCcccCC
Q 019777           12 CHSCNLPIT-DVEFS-MSGNRPYHKHCYKEQH--HPKCDVCQN   50 (336)
Q Consensus        12 C~~C~~~L~-~~~F~-~~dg~~yC~~CY~~~~--~pkC~~C~~   50 (336)
                      |..|...+. ...+. ..=|..+|..|..++.  ..+|..|++
T Consensus         2 C~~C~~~~~~~~~~~l~~CgH~~C~~C~~~~~~~~~~CP~C~k   44 (44)
T PF14634_consen    2 CNICFEKYSEERRPRLTSCGHIFCEKCLKKLKGKSVKCPICRK   44 (44)
T ss_pred             CcCcCccccCCCCeEEcccCCHHHHHHHHhhcCCCCCCcCCCC
Confidence            677878873 22343 4558999999998877  667887764


No 57 
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=52.66  E-value=6.2  Score=35.61  Aligned_cols=51  Identities=24%  Similarity=0.540  Sum_probs=39.0

Q ss_pred             CCCCCccCCCCccCCCCCceEEcCCCceeccchhhhcccCCCCCCchhhHHH
Q 019777           78 RDGTPRCCSCERMEPRDTKYLSLDDGRKLCLECLDSAIMDTHECQPLYLEIQ  129 (336)
Q Consensus        78 H~~CF~C~~C~~~l~~~~~f~~~~dG~~yC~~C~~~~v~~~~~C~~c~~~I~  129 (336)
                      -..||+|-.|--....... +.-+=|.++|..|...++..+..|--|.+.|.
T Consensus       128 ~~~~~~CPiCl~~~sek~~-vsTkCGHvFC~~Cik~alk~~~~CP~C~kkIt  178 (187)
T KOG0320|consen  128 KEGTYKCPICLDSVSEKVP-VSTKCGHVFCSQCIKDALKNTNKCPTCRKKIT  178 (187)
T ss_pred             cccccCCCceecchhhccc-cccccchhHHHHHHHHHHHhCCCCCCcccccc
Confidence            4678999999766532222 23346999999999999999999999987774


No 58 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=52.38  E-value=8.5  Score=27.49  Aligned_cols=30  Identities=23%  Similarity=0.713  Sum_probs=21.8

Q ss_pred             ccCCCCccCCCCCceEEcCCCceeccchhhhc
Q 019777           83 RCCSCERMEPRDTKYLSLDDGRKLCLECLDSA  114 (336)
Q Consensus        83 ~C~~C~~~l~~~~~f~~~~dG~~yC~~C~~~~  114 (336)
                      .|..|+..++.-.++ -+.|| .+|..|+.++
T Consensus         1 ~C~iCg~kigl~~~~-k~~DG-~iC~~C~~Kl   30 (51)
T PF14471_consen    1 KCAICGKKIGLFKRF-KIKDG-YICKDCLKKL   30 (51)
T ss_pred             CCCccccccccccce-eccCc-cchHHHHHHh
Confidence            488899887644443 46688 6899999885


No 59 
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=52.28  E-value=5.2  Score=35.24  Aligned_cols=54  Identities=15%  Similarity=0.394  Sum_probs=35.6

Q ss_pred             CccccccccccccCCcCcccCCcccCCC--CceEEEeeecccccccCCCCcCCCCCccCCCCccCCCCC
Q 019777           29 NRPYHKHCYKEQHHPKCDVCQNFIPTNS--AGLIEYRAHPFWLQKYCPSHERDGTPRCCSCERMEPRDT   95 (336)
Q Consensus        29 g~~yC~~CY~~~~~pkC~~C~~~I~~~~--~g~i~~~~~~fW~qkyCp~H~H~~CF~C~~C~~~l~~~~   95 (336)
                      ..-||.+|-.+ .-..|..|+.+|.|..  +|++.+. ..|          +.-- -|..||+++|+..
T Consensus        27 ~~~fC~kCG~~-tI~~Cp~C~~~IrG~y~v~gv~~~g-~~~----------~~Ps-YC~~CGkpyPWt~   82 (158)
T PF10083_consen   27 REKFCSKCGAK-TITSCPNCSTPIRGDYHVEGVFGLG-GHY----------EAPS-YCHNCGKPYPWTE   82 (158)
T ss_pred             HHHHHHHhhHH-HHHHCcCCCCCCCCceecCCeeeeC-CCC----------CCCh-hHHhCCCCCchHH
Confidence            46789999876 4568999999999863  1333332 221          3222 3899999998544


No 60 
>PF01421 Reprolysin:  Reprolysin (M12B) family zinc metalloprotease  This Prosite motif covers only the active site.;  InterPro: IPR001590 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M12, subfamily M12B (adamalysin family, clan (MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The adamalysins are zinc dependent endopeptidases found in snake venom. There are some mammalian proteins such as P78325 from SWISSPROT, and fertilin Q28472 from SWISSPROT. Fertilin and closely related proteins appear to not have some active site residues and may not be active enzymes. CD156 (also called ADAM8 (3.4.24 from EC) or MS2 human) has been implicated in extravasation of leukocytes. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2E3X_A 2W15_A 2W14_A 2W13_A 2W12_A 1ND1_A 3K7L_A 2DW2_A 2DW0_B 2DW1_A ....
Probab=50.47  E-value=15  Score=32.79  Aligned_cols=24  Identities=29%  Similarity=0.252  Sum_probs=18.7

Q ss_pred             EEEEecCCChhhhhhhHHHHHHHH
Q 019777          214 AILILYGLPRLLTGSILAHEMMHA  237 (336)
Q Consensus       214 ~ilvl~glp~~~~~~~lahe~~ha  237 (336)
                      +|....+..-+.++.++|||++|.
T Consensus       119 ~i~~~~~~~~~~~a~~~AHelGH~  142 (199)
T PF01421_consen  119 GIVEDHSRSGLSFAVIIAHELGHN  142 (199)
T ss_dssp             EEEE-SSSSHHHHHHHHHHHHHHH
T ss_pred             cEeeeccchhHHHHHHHHHHHHHh
Confidence            555555677888999999999995


No 61 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=50.20  E-value=8.3  Score=25.58  Aligned_cols=26  Identities=19%  Similarity=0.322  Sum_probs=18.9

Q ss_pred             eeecCCCCCCCCCceeecCCcccccccccc
Q 019777           10 FRCHSCNLPITDVEFSMSGNRPYHKHCYKE   39 (336)
Q Consensus        10 F~C~~C~~~L~~~~F~~~dg~~yC~~CY~~   39 (336)
                      +.|..|+..    .|...||..||..|-.+
T Consensus         9 ~~C~~C~~~----~~~~~dG~~yC~~cG~~   34 (36)
T PF11781_consen    9 EPCPVCGSR----WFYSDDGFYYCDRCGHQ   34 (36)
T ss_pred             CcCCCCCCe----EeEccCCEEEhhhCceE
Confidence            347777654    57778999999888643


No 62 
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=48.07  E-value=1.9  Score=28.31  Aligned_cols=28  Identities=18%  Similarity=0.487  Sum_probs=21.7

Q ss_pred             ecCCCCCCCCCceeecCCcccccccccc
Q 019777           12 CHSCNLPITDVEFSMSGNRPYHKHCYKE   39 (336)
Q Consensus        12 C~~C~~~L~~~~F~~~dg~~yC~~CY~~   39 (336)
                      |..|+.+|........++..+|.+|..+
T Consensus         6 C~~CGe~I~~~Rl~~~p~~~~C~~C~~~   33 (36)
T PF01258_consen    6 CEDCGEPIPEERLVAVPGATLCVECQER   33 (36)
T ss_dssp             -TTTSSBEEHHHHHHCTTECS-HHHHHH
T ss_pred             ccccCChHHHHHHHhCCCcEECHHHhCc
Confidence            8999999988777777889999998754


No 63 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=48.01  E-value=5.9  Score=25.54  Aligned_cols=40  Identities=13%  Similarity=0.404  Sum_probs=24.6

Q ss_pred             ecCCCCCCCCCceeecCCcccccccccccc---CCcCcccCCc
Q 019777           12 CHSCNLPITDVEFSMSGNRPYHKHCYKEQH---HPKCDVCQNF   51 (336)
Q Consensus        12 C~~C~~~L~~~~F~~~dg~~yC~~CY~~~~---~pkC~~C~~~   51 (336)
                      |..|...+........=|..||..|..+.+   ..+|..|+..
T Consensus         2 C~iC~~~~~~~~~~~~C~H~~c~~C~~~~~~~~~~~Cp~C~~~   44 (45)
T cd00162           2 CPICLEEFREPVVLLPCGHVFCRSCIDKWLKSGKNTCPLCRTP   44 (45)
T ss_pred             CCcCchhhhCceEecCCCChhcHHHHHHHHHhCcCCCCCCCCc
Confidence            667777773322223357788888886433   3467777764


No 64 
>PF02163 Peptidase_M50:  Peptidase family M50;  InterPro: IPR008915 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This entry contains metallopeptidases belonging to MEROPS peptidase family M50 (S2P protease family, clan MM).  Members of the M50 metallopeptidase family include: mammalian sterol-regulatory element binding protein (SREBP) site 2 protease, Escherichia coli protease EcfE, stage IV sporulation protein FB and various hypothetical bacterial and eukaryotic homologues. A number of proteins are classified as non-peptidase homologues as they either have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity.; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3B4R_A 3ID4_A 3ID2_A 2ZPL_B 3ID1_A 2ZPM_A 3ID3_B 2HGA_A.
Probab=47.85  E-value=14  Score=32.60  Aligned_cols=21  Identities=38%  Similarity=0.298  Sum_probs=15.2

Q ss_pred             hhhhhHHHHHHHHHHHhc-CCC
Q 019777          225 LTGSILAHEMMHAWLRLK-GYP  245 (336)
Q Consensus       225 ~~~~~lahe~~ha~l~~~-g~~  245 (336)
                      +..+++.||++|++.... |.+
T Consensus         6 ~~i~i~~HE~gH~~~a~~~G~~   27 (192)
T PF02163_consen    6 LLISIVLHELGHALAARLYGDK   27 (192)
T ss_dssp             HHHHHHHHHHHHHHHHHTTT--
T ss_pred             cccccccccccccccccccccc
Confidence            456899999999997653 543


No 65 
>smart00235 ZnMc Zinc-dependent metalloprotease. Neutral zinc metallopeptidases. This alignment represents a subset of known subfamilies. Highest similarity occurs in the HExxH zinc-binding site/ active site.
Probab=47.84  E-value=9.2  Score=32.03  Aligned_cols=11  Identities=45%  Similarity=0.646  Sum_probs=9.7

Q ss_pred             hhHHHHHHHHH
Q 019777          228 SILAHEMMHAW  238 (336)
Q Consensus       228 ~~lahe~~ha~  238 (336)
                      .+++||+|||-
T Consensus        88 ~~~~HEigHaL   98 (140)
T smart00235       88 GVAAHELGHAL   98 (140)
T ss_pred             ccHHHHHHHHh
Confidence            49999999994


No 66 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=47.47  E-value=19  Score=32.98  Aligned_cols=31  Identities=16%  Similarity=0.323  Sum_probs=22.8

Q ss_pred             CCeeecCCCCCCCCCceeecCCcccccccccc
Q 019777            8 ECFRCHSCNLPITDVEFSMSGNRPYHKHCYKE   39 (336)
Q Consensus         8 ~CF~C~~C~~~L~~~~F~~~dg~~yC~~CY~~   39 (336)
                      +.|.|..|...+.+ .....=|..||..|-.+
T Consensus        17 ~~~~CpICld~~~d-PVvT~CGH~FC~~CI~~   47 (193)
T PLN03208         17 GDFDCNICLDQVRD-PVVTLCGHLFCWPCIHK   47 (193)
T ss_pred             CccCCccCCCcCCC-cEEcCCCchhHHHHHHH
Confidence            46889999887755 34445688999999854


No 67 
>PF14247 DUF4344:  Domain of unknown function (DUF4344)
Probab=47.45  E-value=26  Score=32.60  Aligned_cols=38  Identities=32%  Similarity=0.254  Sum_probs=28.0

Q ss_pred             hhhhHHHHHHHHHHHhcCCCCCCcchhhhHHHHHHHHhhh
Q 019777          226 TGSILAHEMMHAWLRLKGYPNLRPDVEEGICQVLAHMWLE  265 (336)
Q Consensus       226 ~~~~lahe~~ha~l~~~g~~~l~~~veeg~cq~~a~~wl~  265 (336)
                      +-.||-||++||.+-+.+.|.|-  -||--.-.+|-+.|-
T Consensus        92 ~~~~l~HE~GHAlI~~~~lPv~G--rEEDaaD~lAa~~ll  129 (220)
T PF14247_consen   92 VLFTLYHELGHALIDDLDLPVLG--REEDAADQLAALLLL  129 (220)
T ss_pred             HHHHHHHHHHHHHHHHhcCCccc--chhhHHHHHHHHHHh
Confidence            45789999999999998777665  467766666555543


No 68 
>PF10235 Cript:  Microtubule-associated protein CRIPT;  InterPro: IPR019367  The CRIPT protein is a cytoskeletal protein involved in microtubule production. This C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners []. 
Probab=47.34  E-value=12  Score=30.09  Aligned_cols=24  Identities=21%  Similarity=0.483  Sum_probs=13.0

Q ss_pred             CccccccccccccCCcCcccCCcccC
Q 019777           29 NRPYHKHCYKEQHHPKCDVCQNFIPT   54 (336)
Q Consensus        29 g~~yC~~CY~~~~~pkC~~C~~~I~~   54 (336)
                      |.-||..|-.+  .-.|+-|++.|.+
T Consensus        58 g~~YCq~CAYk--kGiCamCGKki~d   81 (90)
T PF10235_consen   58 GAKYCQTCAYK--KGICAMCGKKILD   81 (90)
T ss_pred             CCccChhhhcc--cCcccccCCeecc
Confidence            44566666433  2356666666643


No 69 
>cd04267 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADAM_like or reprolysin_like subgroup. The adamalysin_like or ADAM family of metalloproteases contains proteolytic domains from snake venoms, proteases from the mammalian reproductive tract, and the tumor necrosis factor alpha convertase, TACE. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions.
Probab=47.33  E-value=13  Score=32.99  Aligned_cols=24  Identities=33%  Similarity=0.373  Sum_probs=17.1

Q ss_pred             EEEEecCCChhhhhhhHHHHHHHHH
Q 019777          214 AILILYGLPRLLTGSILAHEMMHAW  238 (336)
Q Consensus       214 ~ilvl~glp~~~~~~~lahe~~ha~  238 (336)
                      +|....+ +.+..+.++|||++|.+
T Consensus       122 ~v~~~~~-~~~~~~~~~aHElGH~l  145 (192)
T cd04267         122 GVVEDTG-FTLLTALTMAHELGHNL  145 (192)
T ss_pred             EEEecCC-cceeehhhhhhhHHhhc
Confidence            3433333 36788899999999976


No 70 
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only]
Probab=46.26  E-value=14  Score=34.72  Aligned_cols=42  Identities=17%  Similarity=0.370  Sum_probs=31.0

Q ss_pred             cCCCCCCCCCceee-cCCccccccccccccCCcCcccCCcccC
Q 019777           13 HSCNLPITDVEFSM-SGNRPYHKHCYKEQHHPKCDVCQNFIPT   54 (336)
Q Consensus        13 ~~C~~~L~~~~F~~-~dg~~yC~~CY~~~~~pkC~~C~~~I~~   54 (336)
                      ..|+..-....|+. .=..++|..|...-..+.|..|+++|..
T Consensus         7 n~C~~~~~~~~f~LTaC~HvfC~~C~k~~~~~~C~lCkk~ir~   49 (233)
T KOG4739|consen    7 NKCFRFPSQDPFFLTACRHVFCEPCLKASSPDVCPLCKKSIRI   49 (233)
T ss_pred             ccccccCCCCceeeeechhhhhhhhcccCCccccccccceeee
Confidence            34433333556665 5589999999998788899999999764


No 71 
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily. This group contains matrix metalloproteinases (MMPs), serralysins, and the astacin_like family of proteases.
Probab=46.24  E-value=11  Score=32.27  Aligned_cols=14  Identities=29%  Similarity=0.268  Sum_probs=12.0

Q ss_pred             hhhhhHHHHHHHHH
Q 019777          225 LTGSILAHEMMHAW  238 (336)
Q Consensus       225 ~~~~~lahe~~ha~  238 (336)
                      ..-.+++||++||-
T Consensus        93 ~~~~~~~HEiGHaL  106 (165)
T cd04268          93 RLRNTAEHELGHAL  106 (165)
T ss_pred             HHHHHHHHHHHHHh
Confidence            45689999999996


No 72 
>cd06158 S2P-M50_like_1 Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with a minimal core protein and no PDZ domains.
Probab=46.09  E-value=14  Score=32.99  Aligned_cols=18  Identities=28%  Similarity=0.475  Sum_probs=14.4

Q ss_pred             hhhhhHHHHHHHHHHHhc
Q 019777          225 LTGSILAHEMMHAWLRLK  242 (336)
Q Consensus       225 ~~~~~lahe~~ha~l~~~  242 (336)
                      +.-|++.||++|||....
T Consensus         8 ~~~~i~~HE~aHa~~A~~   25 (181)
T cd06158           8 VLLAITLHEFAHAYVAYR   25 (181)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            345899999999997664


No 73 
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=45.97  E-value=5.5  Score=36.57  Aligned_cols=45  Identities=16%  Similarity=0.352  Sum_probs=34.1

Q ss_pred             eeecCCCCCCCCCceeecCCcccccccccccc--CCcCcccCCcccCC
Q 019777           10 FRCHSCNLPITDVEFSMSGNRPYHKHCYKEQH--HPKCDVCQNFIPTN   55 (336)
Q Consensus        10 F~C~~C~~~L~~~~F~~~dg~~yC~~CY~~~~--~pkC~~C~~~I~~~   55 (336)
                      |.|..|++...+ .....-|..||..|+.+.+  ++.|.+|++...+.
T Consensus       197 F~C~iCKkdy~s-pvvt~CGH~FC~~Cai~~y~kg~~C~~Cgk~t~G~  243 (259)
T COG5152         197 FLCGICKKDYES-PVVTECGHSFCSLCAIRKYQKGDECGVCGKATYGR  243 (259)
T ss_pred             eeehhchhhccc-hhhhhcchhHHHHHHHHHhccCCcceecchhhccc
Confidence            789999887754 3444568889999987654  67899999877664


No 74 
>PF01863 DUF45:  Protein of unknown function DUF45;  InterPro: IPR002725 Members of this family are found in some archaebacteria, as well as Helicobacter pylori. The proteins are 190-240 amino acids long, with the C terminus being the most conserved region, containing three conserved histidines.
Probab=45.77  E-value=12  Score=33.26  Aligned_cols=27  Identities=22%  Similarity=0.245  Sum_probs=21.4

Q ss_pred             EEEEEEecCCChhhhhhhHHHHHHHHH
Q 019777          212 VTAILILYGLPRLLTGSILAHEMMHAW  238 (336)
Q Consensus       212 v~~ilvl~glp~~~~~~~lahe~~ha~  238 (336)
                      ++-=+-|.-+|.-+.-.|++|||+|..
T Consensus       150 I~ln~~L~~~P~~~idYVvvHEL~Hl~  176 (205)
T PF01863_consen  150 ITLNWRLVMAPPEVIDYVVVHELCHLR  176 (205)
T ss_pred             EEeecccccCCccHHHHHHHHHHHHhc
Confidence            333345666999999999999999974


No 75 
>TIGR02411 leuko_A4_hydro leukotriene A-4 hydrolase/aminopeptidase. Members of this family represent a distinctive subset within the zinc metallopeptidase family M1 (pfam01433). The majority of the members of pfam01433 are aminopeptidases, but the sequences in this family for which the function is known are leukotriene A-4 hydrolase. A dual epoxide hydrolase and aminopeptidase activity at the same active site is indicated. The physiological substrate for aminopeptidase activity is not known.
Probab=45.73  E-value=15  Score=38.96  Aligned_cols=40  Identities=20%  Similarity=0.222  Sum_probs=28.2

Q ss_pred             hhhHHHHHHHHHHHhc-CCCCC-CcchhhhHHHHHHHHhhhc
Q 019777          227 GSILAHEMMHAWLRLK-GYPNL-RPDVEEGICQVLAHMWLES  266 (336)
Q Consensus       227 ~~~lahe~~ha~l~~~-g~~~l-~~~veeg~cq~~a~~wl~~  266 (336)
                      ..++|||++|-|.--- .-..= +..+-||++-.+.+.+++.
T Consensus       280 ~~viaHElAHqWfGNlVT~~~W~d~WLnEGfaty~e~~~~~~  321 (601)
T TIGR02411       280 VDVIAHELAHSWSGNLVTNCSWEHFWLNEGWTVYLERRIVGR  321 (601)
T ss_pred             hhhHHHHHHhhccCceeecCCchHHHHHhhHHHHHHHHHHHH
Confidence            3699999999997421 11111 3578999999998877653


No 76 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=45.59  E-value=13  Score=31.92  Aligned_cols=24  Identities=25%  Similarity=0.549  Sum_probs=19.4

Q ss_pred             cCCCCccCCCCCceEEcCCCceeccchhhhc
Q 019777           84 CCSCERMEPRDTKYLSLDDGRKLCLECLDSA  114 (336)
Q Consensus        84 C~~C~~~l~~~~~f~~~~dG~~yC~~C~~~~  114 (336)
                      |..|+.+|      |. .||..||+.|-.+.
T Consensus        31 Cp~Cg~PL------F~-KdG~v~CPvC~~~~   54 (131)
T COG1645          31 CPKCGTPL------FR-KDGEVFCPVCGYRE   54 (131)
T ss_pred             CcccCCcc------ee-eCCeEECCCCCceE
Confidence            88899998      34 49999999997544


No 77 
>PRK04860 hypothetical protein; Provisional
Probab=45.48  E-value=15  Score=32.41  Aligned_cols=27  Identities=19%  Similarity=0.380  Sum_probs=20.8

Q ss_pred             ChhhhhhhHHHHHHHHHHHhc-C--CCCCCc
Q 019777          222 PRLLTGSILAHEMMHAWLRLK-G--YPNLRP  249 (336)
Q Consensus       222 p~~~~~~~lahe~~ha~l~~~-g--~~~l~~  249 (336)
                      +.-.+-.|++|||+|.++.+. |  +|. +.
T Consensus        59 ~~~~l~~~v~HEl~H~~~~~~~g~~~~H-g~   88 (160)
T PRK04860         59 QQAFIDEVVPHELAHLLVYQLFGRVAPH-GK   88 (160)
T ss_pred             cHHHHHhHHHHHHHHHHHHHHcCCCCCC-CH
Confidence            455667899999999999976 4  555 44


No 78 
>KOG1420 consensus Ca2+-activated K+ channel Slowpoke, alpha subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms]
Probab=44.45  E-value=27  Score=37.11  Aligned_cols=6  Identities=17%  Similarity=0.224  Sum_probs=2.4

Q ss_pred             HHHHhh
Q 019777          311 GKFFKH  316 (336)
Q Consensus       311 ~~~~~~  316 (336)
                      -.|+..
T Consensus        50 w~fl~s   55 (1103)
T KOG1420|consen   50 WAFLAS   55 (1103)
T ss_pred             HHHHHH
Confidence            344443


No 79 
>KOG2130 consensus Phosphatidylserine-specific receptor PtdSerR, contains JmjC domain [Chromatin structure and dynamics; Signal transduction mechanisms]
Probab=43.94  E-value=23  Score=34.90  Aligned_cols=12  Identities=25%  Similarity=0.415  Sum_probs=7.0

Q ss_pred             cHHHHHHhhcCc
Q 019777          149 ERQALNEAMEGE  160 (336)
Q Consensus       149 ~~~ALn~a~~~e  160 (336)
                      .-+|-|..+.+.
T Consensus       200 gTSAWNtll~Gh  211 (407)
T KOG2130|consen  200 GTSAWNTLLQGH  211 (407)
T ss_pred             chHHHHHHhhcc
Confidence            356667766443


No 80 
>PF00413 Peptidase_M10:  Matrixin This Prosite motif covers only the active site.;  InterPro: IPR001818 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M10 (clan MA(M)).  The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. Sequences having this domain are extracellular metalloproteases, such as collagenase and stromelysin, which degrade the extracellular matrix, are known as matrixins. They are zinc-dependent, calcium-activated proteases synthesised as inactive precursors (zymogens), which are proteolytically cleaved to yield the active enzyme [, ]. All matrixins and related proteins possess 2 domains: an N-terminal domain, and a zinc-binding active site domain. The N-terminal domain peptide, cleaved during the activation step, includes a conserved PRCGVPDV octapeptide, known as the cysteine switch, whose Cys residue chelates the active site zinc atom, rendering the enzyme inactive [, ]. The active enzyme degrades components of the extracellular matrix, playing a role in the initial steps of tissue remodelling during morphogenesis, wound healing, angiogenesis and tumour invasion [, ].; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0031012 extracellular matrix; PDB: 1Q3A_C 3V96_B 1HV5_D 1CXV_A 1SRP_A 1FBL_A 1ZVX_A 1JH1_A 1I76_A 2OY4_A ....
Probab=43.58  E-value=13  Score=31.26  Aligned_cols=18  Identities=28%  Similarity=0.108  Sum_probs=13.9

Q ss_pred             CChhhhhhhHHHHHHHHH
Q 019777          221 LPRLLTGSILAHEMMHAW  238 (336)
Q Consensus       221 lp~~~~~~~lahe~~ha~  238 (336)
                      .+......++.||++||-
T Consensus       100 ~~~~~~~~v~~HEiGHaL  117 (154)
T PF00413_consen  100 DSGNDLQSVAIHEIGHAL  117 (154)
T ss_dssp             SSSEEHHHHHHHHHHHHT
T ss_pred             hhhhhhhhhhhhcccccc
Confidence            344556789999999994


No 81 
>TIGR02289 M3_not_pepF oligoendopeptidase, M3 family. This family consists of probable oligoendopeptidases in the M3 family, related to lactococcal PepF and group B streptococcal PepB (TIGR00181) but in a distinct clade with considerable sequence differences. The likely substrate is small peptides and not whole proteins, as with PepF, but members are not characterized and the activity profile may differ. Several bacteria have both a member of this family and a member of the PepF family.
Probab=42.31  E-value=30  Score=36.25  Aligned_cols=45  Identities=22%  Similarity=0.187  Sum_probs=28.8

Q ss_pred             hhhhhhHHHHHHHHH---HHhcC----CCCCCcchhh---hHHHHHHHHhhhccc
Q 019777          224 LLTGSILAHEMMHAW---LRLKG----YPNLRPDVEE---GICQVLAHMWLESEI  268 (336)
Q Consensus       224 ~~~~~~lahe~~ha~---l~~~g----~~~l~~~vee---g~cq~~a~~wl~~~~  268 (336)
                      .---.+||||++||+   +--++    +...+.++-|   =+++.+.+-||....
T Consensus       335 ~~dv~TL~HElGHa~H~~~s~~~~~~~~~~~~~~~aE~aS~~~E~l~~~~l~~~~  389 (549)
T TIGR02289       335 SGDIDVLTHEAGHAFHVYESRKDLLPEYRWPTYEAAELASMSMELLSMPWWDLFY  389 (549)
T ss_pred             hhHHHHHHHHhhHHHHHHHhcCCcccccccCcchhhhhhHHHHHHHHHHHHHHHc
Confidence            344578999999997   32222    3333445555   678888888876543


No 82 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=41.80  E-value=25  Score=37.82  Aligned_cols=22  Identities=23%  Similarity=0.520  Sum_probs=11.8

Q ss_pred             ccCCCCccCCCCCceEEcCCCceeccchhhh
Q 019777           83 RCCSCERMEPRDTKYLSLDDGRKLCLECLDS  113 (336)
Q Consensus        83 ~C~~C~~~l~~~~~f~~~~dG~~yC~~C~~~  113 (336)
                      .|..|+..++         .+..+|.+|-.+
T Consensus        29 ~Cp~CG~~~~---------~~~~fC~~CG~~   50 (645)
T PRK14559         29 PCPQCGTEVP---------VDEAHCPNCGAE   50 (645)
T ss_pred             cCCCCCCCCC---------cccccccccCCc
Confidence            3666666554         233446666544


No 83 
>cd00203 ZnMc Zinc-dependent metalloprotease. This super-family of metalloproteases contains two major branches, the astacin-like proteases and the adamalysin/reprolysin-like proteases. Both branches have wide phylogenetic distribution, and contain sub-families, which are involved in vertebrate development and disease.
Probab=41.62  E-value=19  Score=30.63  Aligned_cols=16  Identities=31%  Similarity=0.329  Sum_probs=13.7

Q ss_pred             hhhhhhhHHHHHHHHH
Q 019777          223 RLLTGSILAHEMMHAW  238 (336)
Q Consensus       223 ~~~~~~~lahe~~ha~  238 (336)
                      ...+..+++||++|+.
T Consensus        93 ~~~~~~~~~HElGH~L  108 (167)
T cd00203          93 TKEGAQTIAHELGHAL  108 (167)
T ss_pred             cccchhhHHHHHHHHh
Confidence            3477899999999997


No 84 
>PF12674 Zn_ribbon_2:  Putative zinc ribbon domain
Probab=41.34  E-value=11  Score=29.61  Aligned_cols=29  Identities=28%  Similarity=0.668  Sum_probs=21.0

Q ss_pred             eecCCCCCCCCCcee--ecC---Ccccccccccc
Q 019777           11 RCHSCNLPITDVEFS--MSG---NRPYHKHCYKE   39 (336)
Q Consensus        11 ~C~~C~~~L~~~~F~--~~d---g~~yC~~CY~~   39 (336)
                      .|..|+.||.....+  +.|   +.-||.-||..
T Consensus         2 ~CQSCGMPl~~~~~~Gte~dGs~s~~YC~yCy~~   35 (81)
T PF12674_consen    2 FCQSCGMPLSKDEDFGTEADGSKSEDYCSYCYQN   35 (81)
T ss_pred             cCCcCcCccCCccccccccCCCCchhHHHHHhcC
Confidence            489999999875532  233   35799999975


No 85 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=41.28  E-value=9.9  Score=28.22  Aligned_cols=15  Identities=27%  Similarity=0.428  Sum_probs=6.8

Q ss_pred             ccCCCCccCCCCCce
Q 019777           83 RCCSCERMEPRDTKY   97 (336)
Q Consensus        83 ~C~~C~~~l~~~~~f   97 (336)
                      .|.+|+..|..++.+
T Consensus        11 ~CtSCg~~i~p~e~~   25 (61)
T COG2888          11 VCTSCGREIAPGETA   25 (61)
T ss_pred             eeccCCCEeccCCce
Confidence            455555554334433


No 86 
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only]
Probab=40.75  E-value=5.3  Score=36.16  Aligned_cols=51  Identities=16%  Similarity=0.280  Sum_probs=39.3

Q ss_pred             cCCCCCccCCCCccCCCCCceEEcCCCceeccchhhhcccCCCCCCchhhHH
Q 019777           77 ERDGTPRCCSCERMEPRDTKYLSLDDGRKLCLECLDSAIMDTHECQPLYLEI  128 (336)
Q Consensus        77 ~H~~CF~C~~C~~~l~~~~~f~~~~dG~~yC~~C~~~~v~~~~~C~~c~~~I  128 (336)
                      ||..|..|..|...+......+.. +|..||...+.........|..|...|
T Consensus        19 ~~~~~~~~~~~~~~~~~~~~~~~~-~g~~~~~~d~~~~~~~~~rr~rt~~~~   69 (235)
T KOG0490|consen   19 WHASCLKCAECDNPLGVGDTCFSK-DGSIYCKRDYQREFKFSKRCARCKFTI   69 (235)
T ss_pred             HHHHHHhhhhhcchhccCCCcccC-CCcccccccchhhhhccccccCCCCCc
Confidence            399999999999998544556666 999999999886334566777777665


No 87 
>PF13688 Reprolysin_5:  Metallo-peptidase family M12; PDB: 2FV5_B 3EWJ_A 3KME_A 3L0T_B 1BKC_E 3G42_D 2I47_D 2FV9_B 3LEA_A 1ZXC_B ....
Probab=40.60  E-value=15  Score=32.50  Aligned_cols=18  Identities=28%  Similarity=0.318  Sum_probs=14.2

Q ss_pred             CChhhhhhhHHHHHHHHH
Q 019777          221 LPRLLTGSILAHEMMHAW  238 (336)
Q Consensus       221 lp~~~~~~~lahe~~ha~  238 (336)
                      .|......++|||++|.+
T Consensus       137 ~~~~~~~~~~AHEiGH~l  154 (196)
T PF13688_consen  137 PPTYNGAITFAHEIGHNL  154 (196)
T ss_dssp             --HHHHHHHHHHHHHHHT
T ss_pred             CCCCceehhhHHhHHHhc
Confidence            446777899999999987


No 88 
>PF08219 TOM13:  Outer membrane protein TOM13;  InterPro: IPR013262 The TOM13 family of proteins are mitochondrial outer membrane proteins that mediate the assembly of beta-barrel proteins [].; GO: 0005741 mitochondrial outer membrane
Probab=40.58  E-value=19  Score=28.02  Aligned_cols=25  Identities=24%  Similarity=0.218  Sum_probs=18.9

Q ss_pred             hhhhhhhHHHHHHHHHHHhcCCCCCC
Q 019777          223 RLLTGSILAHEMMHAWLRLKGYPNLR  248 (336)
Q Consensus       223 ~~~~~~~lahe~~ha~l~~~g~~~l~  248 (336)
                      +|=||-|+|||+.+-|=+ .|++--|
T Consensus        49 MLGFGEl~AhE~~fr~gW-~g~ki~P   73 (77)
T PF08219_consen   49 MLGFGELFAHEIAFRLGW-SGTKIFP   73 (77)
T ss_pred             hHhHHHHHHHHHHHHhcc-CcceecC
Confidence            688999999999887744 4665433


No 89 
>PRK00420 hypothetical protein; Validated
Probab=40.49  E-value=20  Score=29.98  Aligned_cols=26  Identities=23%  Similarity=0.369  Sum_probs=19.6

Q ss_pred             ccCCCCccCCCCCceEEcCCCceeccchhhhc
Q 019777           83 RCCSCERMEPRDTKYLSLDDGRKLCLECLDSA  114 (336)
Q Consensus        83 ~C~~C~~~l~~~~~f~~~~dG~~yC~~C~~~~  114 (336)
                      .|..|+.+|      +.+.+|+.+|+.|-...
T Consensus        25 ~CP~Cg~pL------f~lk~g~~~Cp~Cg~~~   50 (112)
T PRK00420         25 HCPVCGLPL------FELKDGEVVCPVHGKVY   50 (112)
T ss_pred             CCCCCCCcc------eecCCCceECCCCCCee
Confidence            477788776      34459999999997754


No 90 
>PRK14873 primosome assembly protein PriA; Provisional
Probab=40.36  E-value=23  Score=38.27  Aligned_cols=52  Identities=8%  Similarity=0.057  Sum_probs=26.7

Q ss_pred             cccccCCCcccccccccccccccceeEE-EEEEecCCCh-hhhhhhHHHHHHHHH
Q 019777          186 RRPRIGAGYRLIDMITEPYRLIRRCEVT-AILILYGLPR-LLTGSILAHEMMHAW  238 (336)
Q Consensus       186 ~~~r~~~~~~~~~~~t~~~~~~~~~~v~-~ilvl~glp~-~~~~~~lahe~~ha~  238 (336)
                      ..|-.+.+-+..++.++...+.++.+-- .++|. +-|. .+..+.+.|.+--.|
T Consensus       502 ~~pDfRA~Er~~qll~qvagragr~~~~G~V~iq-~~p~~~~~~~l~~~d~~~F~  555 (665)
T PRK14873        502 GRQDLRAAEDTLRRWMAAAALVRPRADGGQVVVV-AESSLPTVQALIRWDPVGHA  555 (665)
T ss_pred             cCCCcChHHHHHHHHHHHHHhhcCCCCCCEEEEE-eCCCCHHHHHHHhCCHHHHH
Confidence            3444455555555555554444332211 23333 4665 455667777776666


No 91 
>PF05299 Peptidase_M61:  M61 glycyl aminopeptidase;  InterPro: IPR007963 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M61 (glycyl aminopeptidase family, clan MA(E)).The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH. The type example is glycyl aminopeptidase from Sphingomonas capsulata.
Probab=39.46  E-value=15  Score=31.02  Aligned_cols=41  Identities=29%  Similarity=0.493  Sum_probs=29.2

Q ss_pred             hhhhHHHHHHHHHH--HhcC--C-------CCCC--cchhhhHHHHHHHHhhhc
Q 019777          226 TGSILAHEMMHAWL--RLKG--Y-------PNLR--PDVEEGICQVLAHMWLES  266 (336)
Q Consensus       226 ~~~~lahe~~ha~l--~~~g--~-------~~l~--~~veeg~cq~~a~~wl~~  266 (336)
                      +-.++|||+-|+|-  |+..  .       |+.+  +-|-||+=+.++.+-|-+
T Consensus         4 ~l~l~sHEffH~WnvkrirP~~l~p~dy~~~~~t~~LWv~EG~T~Y~~~l~l~R   57 (122)
T PF05299_consen    4 FLGLLSHEFFHSWNVKRIRPAELGPFDYEKPNYTELLWVYEGFTSYYGDLLLVR   57 (122)
T ss_pred             hhhhhhhhccccccceEeccccccCCCCCCCCCCCCEeeeeCcHHHHHHHHHHH
Confidence            45789999999994  4432  1       1222  468899999998887655


No 92 
>PRK02870 heat shock protein HtpX; Provisional
Probab=39.36  E-value=24  Score=34.87  Aligned_cols=24  Identities=33%  Similarity=0.461  Sum_probs=17.9

Q ss_pred             EEEEecC----CChhhhhhhHHHHHHHH
Q 019777          214 AILILYG----LPRLLTGSILAHEMMHA  237 (336)
Q Consensus       214 ~ilvl~g----lp~~~~~~~lahe~~ha  237 (336)
                      .|.|-.|    |++--..+|||||++|.
T Consensus       157 ~Ivvt~GLL~~L~~dEL~aVlAHELgHi  184 (336)
T PRK02870        157 MVAITTGLLEKLDRDELQAVMAHELSHI  184 (336)
T ss_pred             EEEEehHHhhhCCHHHHHHHHHHHHHHH
Confidence            3445445    56667789999999997


No 93 
>KOG3714 consensus Meprin A metalloprotease [Posttranslational modification, protein turnover, chaperones]
Probab=39.30  E-value=14  Score=37.45  Aligned_cols=11  Identities=45%  Similarity=0.821  Sum_probs=9.7

Q ss_pred             hhHHHHHHHHH
Q 019777          228 SILAHEMMHAW  238 (336)
Q Consensus       228 ~~lahe~~ha~  238 (336)
                      .|++||||||=
T Consensus       161 G~i~HEl~HaL  171 (411)
T KOG3714|consen  161 GTIVHELMHAL  171 (411)
T ss_pred             chhHHHHHHHh
Confidence            57899999995


No 94 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=38.88  E-value=38  Score=39.10  Aligned_cols=14  Identities=36%  Similarity=0.318  Sum_probs=11.2

Q ss_pred             HHHHHHHHHHHhcC
Q 019777          230 LAHEMMHAWLRLKG  243 (336)
Q Consensus       230 lahe~~ha~l~~~g  243 (336)
                      .||.+-||=.|-|=
T Consensus       906 YAHPyFHAAKRRNC  919 (1337)
T PRK14714        906 YAHPYFHAAKRRNC  919 (1337)
T ss_pred             cccchhhhHhhcCC
Confidence            58999999888763


No 95 
>KOG3624 consensus M13 family peptidase [Amino acid transport and metabolism]
Probab=38.75  E-value=14  Score=39.76  Aligned_cols=15  Identities=27%  Similarity=0.514  Sum_probs=13.2

Q ss_pred             hhhhhHHHHHHHHHH
Q 019777          225 LTGSILAHEMMHAWL  239 (336)
Q Consensus       225 ~~~~~lahe~~ha~l  239 (336)
                      ..|.+|||||+|+|=
T Consensus       517 ~iG~vigHEl~H~FD  531 (687)
T KOG3624|consen  517 GIGFVIGHELTHGFD  531 (687)
T ss_pred             HHHHHHHHHHhhccc
Confidence            479999999999983


No 96 
>PRK04897 heat shock protein HtpX; Provisional
Probab=38.60  E-value=13  Score=35.88  Aligned_cols=19  Identities=21%  Similarity=0.274  Sum_probs=15.9

Q ss_pred             CCChhhhhhhHHHHHHHHH
Q 019777          220 GLPRLLTGSILAHEMMHAW  238 (336)
Q Consensus       220 glp~~~~~~~lahe~~ha~  238 (336)
                      .|++--..+|||||++|.-
T Consensus       131 ~l~~~El~aVlAHElgHi~  149 (298)
T PRK04897        131 IMNREELEGVIGHEISHIR  149 (298)
T ss_pred             hCCHHHHHHHHHHHHHHHh
Confidence            4677778999999999954


No 97 
>KOG3931 consensus Uncharacterized conserved protein [Function unknown]
Probab=38.38  E-value=17  Score=36.28  Aligned_cols=24  Identities=38%  Similarity=0.375  Sum_probs=19.7

Q ss_pred             cCCChhhhhhhHHHHHHHHHHHhc
Q 019777          219 YGLPRLLTGSILAHEMMHAWLRLK  242 (336)
Q Consensus       219 ~glp~~~~~~~lahe~~ha~l~~~  242 (336)
                      .=-||--.--.|-|||.||||...
T Consensus        98 kLRPRkDLVETLLHEMIHAYlFV~  121 (484)
T KOG3931|consen   98 KLRPRKDLVETLLHEMIHAYLFVT  121 (484)
T ss_pred             ccCchHHHHHHHHHHHHHHheeEe
Confidence            334777778899999999999884


No 98 
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones]
Probab=37.95  E-value=16  Score=35.84  Aligned_cols=44  Identities=16%  Similarity=0.501  Sum_probs=29.6

Q ss_pred             eecCCCCCCCCCceeecCCccccccccccccCCcCcccCCcccC
Q 019777           11 RCHSCNLPITDVEFSMSGNRPYHKHCYKEQHHPKCDVCQNFIPT   54 (336)
Q Consensus        11 ~C~~C~~~L~~~~F~~~dg~~yC~~CY~~~~~pkC~~C~~~I~~   54 (336)
                      .|..|+.+|.-..-..--..+||-+|-..---..|..|..+|.-
T Consensus        92 fCd~Cd~PI~IYGRmIPCkHvFCl~CAr~~~dK~Cp~C~d~Vqr  135 (389)
T KOG2932|consen   92 FCDRCDFPIAIYGRMIPCKHVFCLECARSDSDKICPLCDDRVQR  135 (389)
T ss_pred             eecccCCcceeeecccccchhhhhhhhhcCccccCcCcccHHHH
Confidence            47888888865444444567788888765445578888877653


No 99 
>cd06162 S2P-M50_PDZ_SREBP Sterol regulatory element-binding protein (SREBP) Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50A), regulates intramembrane proteolysis (RIP) of SREBP and is part of a signal transduction mechanism involved in sterol and lipid metabolism. In sterol-depleted mammalian cells, a two-step proteolytic process releases the N-terminal domains of SREBPs from membranes of the endoplasmic reticulum (ER). These domains translocate into the nucleus, where they activate genes of cholesterol and fatty acid biosynthesis. The first cleavage occurs at Site-1 within the ER lumen to generate an intermediate that is subsequently released from the membrane by cleavage at Site-2, which lies within the first transmembrane domain. It is the second proteolytic step that is carried out by the SREBP Site-2 protease (S2P) which is present in this CD family.  This group appears to be limited to eumetazoan proteins and contains one PDZ domain.
Probab=37.77  E-value=21  Score=34.47  Aligned_cols=17  Identities=35%  Similarity=0.239  Sum_probs=14.9

Q ss_pred             hhhhhHHHHHHHHHHHh
Q 019777          225 LTGSILAHEMMHAWLRL  241 (336)
Q Consensus       225 ~~~~~lahe~~ha~l~~  241 (336)
                      +..+++.||++||+...
T Consensus       134 l~isvvvHElgHal~A~  150 (277)
T cd06162         134 LLISGVVHEMGHGVAAV  150 (277)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            57799999999999766


No 100
>COG1451 Predicted metal-dependent hydrolase [General function prediction only]
Probab=37.64  E-value=16  Score=33.96  Aligned_cols=27  Identities=19%  Similarity=0.193  Sum_probs=21.6

Q ss_pred             EEEEEEecCCChhhhhhhHHHHHHHHH
Q 019777          212 VTAILILYGLPRLLTGSILAHEMMHAW  238 (336)
Q Consensus       212 v~~ilvl~glp~~~~~~~lahe~~ha~  238 (336)
                      ++==+.|-.+|.-+...|++||++|--
T Consensus       161 i~~~~~l~~~p~~~i~YVvvHELaHLk  187 (223)
T COG1451         161 IRFNWRLVMAPEEVIDYVVVHELAHLK  187 (223)
T ss_pred             EEeehhhhcCCHHHHHHHHHHHHHHHh
Confidence            333346778999999999999999953


No 101
>PRK00420 hypothetical protein; Validated
Probab=37.44  E-value=20  Score=29.98  Aligned_cols=23  Identities=22%  Similarity=0.511  Sum_probs=13.4

Q ss_pred             eecCCCCCCCCCceeecCCcccccccc
Q 019777           11 RCHSCNLPITDVEFSMSGNRPYHKHCY   37 (336)
Q Consensus        11 ~C~~C~~~L~~~~F~~~dg~~yC~~CY   37 (336)
                      .|..|+.||    |-.++|+.||..|-
T Consensus        25 ~CP~Cg~pL----f~lk~g~~~Cp~Cg   47 (112)
T PRK00420         25 HCPVCGLPL----FELKDGEVVCPVHG   47 (112)
T ss_pred             CCCCCCCcc----eecCCCceECCCCC
Confidence            466777666    22266766665553


No 102
>PRK11827 hypothetical protein; Provisional
Probab=37.34  E-value=25  Score=26.15  Aligned_cols=15  Identities=20%  Similarity=0.485  Sum_probs=12.0

Q ss_pred             ceeccccccchhcHH
Q 019777          137 MKVEQQVPLLLVERQ  151 (336)
Q Consensus       137 ~~i~~~~p~~lV~~~  151 (336)
                      .||.+.+|++|++-.
T Consensus        36 YPI~dgIPVlL~deA   50 (60)
T PRK11827         36 FPLRDGIPVLLETEA   50 (60)
T ss_pred             ccccCCccccCHHHh
Confidence            588899999987643


No 103
>PF13574 Reprolysin_2:  Metallo-peptidase family M12B Reprolysin-like; PDB: 1KAP_P 1JIW_P 1AKL_A 1OM7_A 1OM8_A 1O0T_A 1OM6_A 1H71_P 1O0Q_A 1OMJ_A ....
Probab=37.12  E-value=20  Score=31.71  Aligned_cols=13  Identities=31%  Similarity=0.327  Sum_probs=11.4

Q ss_pred             hhhhHHHHHHHHH
Q 019777          226 TGSILAHEMMHAW  238 (336)
Q Consensus       226 ~~~~lahe~~ha~  238 (336)
                      .-.++|||+.|.+
T Consensus       111 ~~~~~aHElGH~l  123 (173)
T PF13574_consen  111 GIDTFAHELGHQL  123 (173)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             eeeeehhhhHhhc
Confidence            5568999999998


No 104
>cd06159 S2P-M50_PDZ_Arch Uncharacterized Archaeal homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group appears to be limited to Archaeal S2P/M50s homologs with additional putative N-terminal transmembrane spanning regions, relative to the core protein, and either one or two PDZ domains present.
Probab=36.91  E-value=23  Score=33.83  Aligned_cols=28  Identities=29%  Similarity=0.483  Sum_probs=19.6

Q ss_pred             EecCCChhhhhhhHHHHHHHHHHHhc-CCC
Q 019777          217 ILYGLPRLLTGSILAHEMMHAWLRLK-GYP  245 (336)
Q Consensus       217 vl~glp~~~~~~~lahe~~ha~l~~~-g~~  245 (336)
                      +++++. .+.-+++.||++||+.... |.+
T Consensus       110 ~~~~~i-aL~isv~iHElgHa~~Ar~~G~~  138 (263)
T cd06159         110 LPYGII-ALVVGVVVHELSHGILARVEGIK  138 (263)
T ss_pred             HHHHHH-HHHHHHHHHHHHHHHHHHHcCCE
Confidence            334442 3577899999999997663 654


No 105
>cd06161 S2P-M50_SpoIVFB SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation. SpoIVFB (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB.
Probab=36.82  E-value=26  Score=31.87  Aligned_cols=22  Identities=41%  Similarity=0.498  Sum_probs=17.4

Q ss_pred             hhhhhhHHHHHHHHHHHhc-CCC
Q 019777          224 LLTGSILAHEMMHAWLRLK-GYP  245 (336)
Q Consensus       224 ~~~~~~lahe~~ha~l~~~-g~~  245 (336)
                      .++.+++.||+.|++.... |.+
T Consensus        36 ~l~~~v~iHElgH~~~A~~~G~~   58 (208)
T cd06161          36 LLFLSVLLHELGHALVARRYGIR   58 (208)
T ss_pred             HHHHHHHHHHHHHHHHHHHcCCC
Confidence            5778999999999996553 654


No 106
>PF04298 Zn_peptidase_2:  Putative neutral zinc metallopeptidase;  InterPro: IPR007395 Members of this family of bacterial proteins are described as hypothetical proteins or zinc-dependent proteases. The majority have a HExxH zinc-binding motif characteristic of neutral zinc metallopeptidases, however there is no evidence to support their function as metallopeptidases.
Probab=35.88  E-value=21  Score=33.31  Aligned_cols=29  Identities=31%  Similarity=0.439  Sum_probs=23.1

Q ss_pred             cCCChhhhhhhHHHHHHHHHHHhcCCCCC
Q 019777          219 YGLPRLLTGSILAHEMMHAWLRLKGYPNL  247 (336)
Q Consensus       219 ~glp~~~~~~~lahe~~ha~l~~~g~~~l  247 (336)
                      |+=.-+..-+|.|||.+||-..-+||.-|
T Consensus        82 y~~~SiaAvaVAAHEvGHAiQ~a~~Y~pl  110 (222)
T PF04298_consen   82 YNGRSIAAVAVAAHEVGHAIQHAEGYAPL  110 (222)
T ss_pred             CCCCCHHHHHHHHHHHhHHHhccccCcHH
Confidence            44455677799999999999999998644


No 107
>cd04279 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_like sub-family 1. A group of bacterial, archaeal, and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=35.69  E-value=19  Score=30.82  Aligned_cols=16  Identities=31%  Similarity=0.223  Sum_probs=13.3

Q ss_pred             hhhhhhhHHHHHHHHH
Q 019777          223 RLLTGSILAHEMMHAW  238 (336)
Q Consensus       223 ~~~~~~~lahe~~ha~  238 (336)
                      ...+-+++.||++||-
T Consensus       101 ~~~~~~~~~HEiGHaL  116 (156)
T cd04279         101 AENLQAIALHELGHAL  116 (156)
T ss_pred             chHHHHHHHHHhhhhh
Confidence            4567799999999985


No 108
>PRK00807 50S ribosomal protein L24e; Validated
Probab=35.62  E-value=11  Score=27.16  Aligned_cols=35  Identities=14%  Similarity=0.334  Sum_probs=21.5

Q ss_pred             cCcccCCcccCCCC-ceEEEeeecccccccCCCCcCCCCCccCCCCccC
Q 019777           44 KCDVCQNFIPTNSA-GLIEYRAHPFWLQKYCPSHERDGTPRCCSCERME   91 (336)
Q Consensus        44 kC~~C~~~I~~~~~-g~i~~~~~~fW~qkyCp~H~H~~CF~C~~C~~~l   91 (336)
                      .|..|+..|.+..+ .++...++.|+             |.+..|.+.+
T Consensus         3 ~C~fcG~~I~pg~G~~~vr~Dgkv~~-------------Fcs~KC~~~f   38 (52)
T PRK00807          3 TCSFCGKEIEPGTGKMYVKKDGTILY-------------FCSSKCEKNY   38 (52)
T ss_pred             ccCCCCCeEcCCCCeEEEEeCCcEEE-------------EeCHHHHHHH
Confidence            68888888884432 22455566662             5555776644


No 109
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=35.29  E-value=34  Score=23.15  Aligned_cols=31  Identities=32%  Similarity=0.706  Sum_probs=19.9

Q ss_pred             ccCCCCccCCCCCceEEcCCCceeccchhhh
Q 019777           83 RCCSCERMEPRDTKYLSLDDGRKLCLECLDS  113 (336)
Q Consensus        83 ~C~~C~~~l~~~~~f~~~~dG~~yC~~C~~~  113 (336)
                      +|+-|+++.......+.-.++-..|..|...
T Consensus         3 ~CSFCgr~~~~v~~li~g~~~~~IC~~Cv~~   33 (41)
T PF06689_consen    3 RCSFCGRPESEVGRLISGPNGAYICDECVEQ   33 (41)
T ss_dssp             B-TTT--BTTTSSSEEEES-SEEEEHHHHHH
T ss_pred             CccCCCCCHHHHhceecCCCCcEECHHHHHH
Confidence            5889999987556666554477889999765


No 110
>PRK03001 M48 family peptidase; Provisional
Probab=35.04  E-value=18  Score=34.48  Aligned_cols=18  Identities=28%  Similarity=0.394  Sum_probs=14.9

Q ss_pred             CChhhhhhhHHHHHHHHH
Q 019777          221 LPRLLTGSILAHEMMHAW  238 (336)
Q Consensus       221 lp~~~~~~~lahe~~ha~  238 (336)
                      |..--..+|||||++|.-
T Consensus       119 l~~~El~aVlAHElgHi~  136 (283)
T PRK03001        119 LSEREIRGVMAHELAHVK  136 (283)
T ss_pred             CCHHHHHHHHHHHHHHHh
Confidence            566667899999999975


No 111
>cd06164 S2P-M50_SpoIVFB_CBS SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation. In this subgroup, SpoIVFB (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain. SpoIVFB is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB. It has been proposed tha
Probab=34.77  E-value=27  Score=32.37  Aligned_cols=22  Identities=41%  Similarity=0.680  Sum_probs=17.4

Q ss_pred             hhhhhhHHHHHHHHHHHhc-CCC
Q 019777          224 LLTGSILAHEMMHAWLRLK-GYP  245 (336)
Q Consensus       224 ~~~~~~lahe~~ha~l~~~-g~~  245 (336)
                      .++.+++.||++|++.... |++
T Consensus        51 ~l~~~v~iHElgH~~~A~~~G~~   73 (227)
T cd06164          51 LLFASVLLHELGHSLVARRYGIP   73 (227)
T ss_pred             HHHHHHHHHHHHHHHHHHHcCCe
Confidence            4788999999999995543 654


No 112
>PRK14015 pepN aminopeptidase N; Provisional
Probab=34.70  E-value=37  Score=37.87  Aligned_cols=41  Identities=20%  Similarity=0.399  Sum_probs=27.5

Q ss_pred             hhhhHHHHHHHHHHHhc-CCCCC-CcchhhhHHHHHHHHhhhc
Q 019777          226 TGSILAHEMMHAWLRLK-GYPNL-RPDVEEGICQVLAHMWLES  266 (336)
Q Consensus       226 ~~~~lahe~~ha~l~~~-g~~~l-~~~veeg~cq~~a~~wl~~  266 (336)
                      ..+++|||+.|-|.-=. -.+.- +..+-||+.-.+...|.+.
T Consensus       296 i~~vIaHElaHqWFGNlVT~~~W~dLWLnEGFAty~e~~~~~~  338 (875)
T PRK14015        296 IESVIAHEYFHNWTGNRVTCRDWFQLSLKEGLTVFRDQEFSAD  338 (875)
T ss_pred             HHHHHHHHHHHHHHhCcceecchhhhhhhhHHHHHHHHHHHHH
Confidence            45899999999995210 00111 2457999999988887654


No 113
>PRK03072 heat shock protein HtpX; Provisional
Probab=34.62  E-value=18  Score=34.83  Aligned_cols=20  Identities=25%  Similarity=0.321  Sum_probs=16.0

Q ss_pred             cCCChhhhhhhHHHHHHHHH
Q 019777          219 YGLPRLLTGSILAHEMMHAW  238 (336)
Q Consensus       219 ~glp~~~~~~~lahe~~ha~  238 (336)
                      .-|.+--..+|+|||+.|.-
T Consensus       120 ~~l~~~El~aVlAHElgHi~  139 (288)
T PRK03072        120 QILNERELRGVLGHELSHVY  139 (288)
T ss_pred             HhCCHHHHHHHHHHHHHHHh
Confidence            34677777899999999964


No 114
>PRK05457 heat shock protein HtpX; Provisional
Probab=34.46  E-value=19  Score=34.65  Aligned_cols=19  Identities=32%  Similarity=0.415  Sum_probs=16.3

Q ss_pred             CCChhhhhhhHHHHHHHHH
Q 019777          220 GLPRLLTGSILAHEMMHAW  238 (336)
Q Consensus       220 glp~~~~~~~lahe~~ha~  238 (336)
                      .|++--..+|+|||+.|.-
T Consensus       128 ~L~~~El~aVlAHElgHi~  146 (284)
T PRK05457        128 NMSRDEVEAVLAHEISHIA  146 (284)
T ss_pred             hCCHHHHHHHHHHHHHHHH
Confidence            4788888999999999963


No 115
>PHA03309 transcriptional regulator ICP4; Provisional
Probab=34.38  E-value=31  Score=38.34  Aligned_cols=15  Identities=33%  Similarity=0.563  Sum_probs=8.0

Q ss_pred             cccccchhcHHHHHH
Q 019777          141 QQVPLLLVERQALNE  155 (336)
Q Consensus       141 ~~~p~~lV~~~ALn~  155 (336)
                      +.+|+.+.....|.+
T Consensus      1494 qdvplpfltaatlrk 1508 (2033)
T PHA03309       1494 QDVPLPFLTAATLRK 1508 (2033)
T ss_pred             CCCCchhhhHHHHHH
Confidence            455655555555544


No 116
>PF01400 Astacin:  Astacin (Peptidase family M12A) This Prosite motif covers only the active site.;  InterPro: IPR001506 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M12, subfamily M12A (astacin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The astacin () family of metalloendopeptidases encompasses a range of proteins found in hydra to humans, in mature and developmental systems []. Their functions include activation of growth factors, degradation of polypeptides, and processing of extracellular proteins []. The proteins are synthesised with N-terminal signal and pro-enzyme sequences, and many contain multiple domains C-terminal to the protease domain. They are either secreted from cells, or are associated with the plasma membrane. The astacin molecule adopts a kidney shape, with a deep active-site cleft between its N- and C-terminal domains []. The zinc ion, which lies at the bottom of the cleft, exhibits a unique penta-coordinated mode of binding, involving 3 histidine residues, a tyrosine and a water molecule (which is also bound to the carboxylate side chain of Glu93) []. The N-terminal domain comprises 2 alpha-helices and a 5-stranded beta-sheet. The overall topology of this domain is shared by the archetypal zinc-endopeptidase thermolysin. Astacin protease domains also share common features with serralysins, matrix metalloendopeptidases, and snake venom proteases; they cleave peptide bonds in polypeptides such as insulin B chain and bradykinin, and in proteins such as casein and gelatin; and they have arylamidase activity [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3LQB_A 3EDH_A 3EDG_A 3EDI_A 1IAE_A 1IAB_A 1IAA_A 1AST_A 1IAC_A 1QJJ_A ....
Probab=34.24  E-value=32  Score=30.88  Aligned_cols=17  Identities=24%  Similarity=0.296  Sum_probs=12.3

Q ss_pred             ChhhhhhhHHHHHHHHH
Q 019777          222 PRLLTGSILAHEMMHAW  238 (336)
Q Consensus       222 p~~~~~~~lahe~~ha~  238 (336)
                      +.-....+++||+|||-
T Consensus        75 ~~c~~~~~i~HEl~HaL   91 (191)
T PF01400_consen   75 DGCFSVGTILHELGHAL   91 (191)
T ss_dssp             TTC-SHHHHHHHHHHHH
T ss_pred             ceeCCccchHHHHHHHH
Confidence            33345578999999996


No 117
>PF10463 Peptidase_U49:  Peptidase U49;  InterPro: IPR019504 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.   The peptidases families associated with clan U- have an unknown catalytic mechanism as the protein fold of the active site domain and the active site residues have not been reported.  This entry contains peptidases belonging to MEROPS peptidase family U49 (Lit peptidase, clan U-). The Lit peptidase from Escherichia coli functions in bacterial cell death in response to infection by Enterobacteria phage T4. Following binding of Gol peptide to domains II and III of elongation factor Tu, the Lit peptidase cleaves domain I of the elongation factor. This prevents binding of guanine nucleotides, shuts down translation and leads to cell death. 
Probab=34.19  E-value=44  Score=30.81  Aligned_cols=48  Identities=25%  Similarity=0.178  Sum_probs=36.3

Q ss_pred             CChhhhhhhHHHHHHHHHHHhcCC-CCCCcchhhhHHHHHHHHhhhccc
Q 019777          221 LPRLLTGSILAHEMMHAWLRLKGY-PNLRPDVEEGICQVLAHMWLESEI  268 (336)
Q Consensus       221 lp~~~~~~~lahe~~ha~l~~~g~-~~l~~~veeg~cq~~a~~wl~~~~  268 (336)
                      |=-...+=+|+||+.|+.+.-.+. ..-...-||==|-..|-.||-+..
T Consensus        96 l~~~A~~fil~HE~~Hv~~~h~~~~~~~~~~~eE~~AD~~A~~~il~~~  144 (206)
T PF10463_consen   96 LFCCAIAFILLHELAHVVLGHEGDSSPSQSIQEEKEADSYATEMILSDV  144 (206)
T ss_pred             HHHHHHHHHHHHHHHHHHHcCccccccchhHHHHHhhhHHHHHHHHHHH
Confidence            334567789999999988887776 444466677789999999975543


No 118
>PRK03982 heat shock protein HtpX; Provisional
Probab=34.17  E-value=20  Score=34.33  Aligned_cols=18  Identities=28%  Similarity=0.313  Sum_probs=15.2

Q ss_pred             CChhhhhhhHHHHHHHHH
Q 019777          221 LPRLLTGSILAHEMMHAW  238 (336)
Q Consensus       221 lp~~~~~~~lahe~~ha~  238 (336)
                      |..--.-+|||||++|.-
T Consensus       120 l~~~El~AVlAHElgHi~  137 (288)
T PRK03982        120 LNEDELEGVIAHELTHIK  137 (288)
T ss_pred             CCHHHHHHHHHHHHHHHH
Confidence            566678899999999975


No 119
>cd04281 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1/TLD-like subfamily. BMP1 (Bone morphogenetic protein 1) and TLD (tolloid)-like metalloproteases play vital roles in extracellular matrix formation, by cleaving precursor proteins such as enzymes, structural proteins, and proteins involved in the mineralization of the extracellular matrix. The drosophila protein tolloid and its Xenopus homologue xolloid cleave and inactivate Sog and chordin, respectively, which are inhibitors of Dpp (the Drosophila decapentaplegic gene product) and its homologue BMP4, involved in dorso-ventral patterning.
Probab=34.10  E-value=21  Score=32.70  Aligned_cols=11  Identities=36%  Similarity=0.591  Sum_probs=9.8

Q ss_pred             hhHHHHHHHHH
Q 019777          228 SILAHEMMHAW  238 (336)
Q Consensus       228 ~~lahe~~ha~  238 (336)
                      .+++||||||-
T Consensus        89 Gti~HEl~HaL   99 (200)
T cd04281          89 GIVVHELGHVI   99 (200)
T ss_pred             chHHHHHHHHh
Confidence            58999999995


No 120
>PF06037 DUF922:  Bacterial protein of unknown function (DUF922);  InterPro: IPR010321 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=33.79  E-value=64  Score=28.44  Aligned_cols=30  Identities=27%  Similarity=0.434  Sum_probs=23.7

Q ss_pred             EEEEEecCCChhh----------------hhhhHHHHHHHHHHHhc
Q 019777          213 TAILILYGLPRLL----------------TGSILAHEMMHAWLRLK  242 (336)
Q Consensus       213 ~~ilvl~glp~~~----------------~~~~lahe~~ha~l~~~  242 (336)
                      ..+-|-|-||++.                ...+.+||..|+=+-.+
T Consensus        57 v~l~itytlPr~~~~~~~~~~~~~~W~~~~a~l~~HE~~H~~ia~~  102 (161)
T PF06037_consen   57 VKLDITYTLPRWSRRAKAPPELRQRWDRFSAGLRRHEEVHGRIARE  102 (161)
T ss_pred             EEEEEEEECCCccccCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3556778899984                67889999999987764


No 121
>cd05709 S2P-M50 Site-2 protease (S2P) class of zinc metalloproteases (MEROPS family M50) cleaves transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of this family use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. The domain core structure appears to contain at least three transmembrane helices with a catalytic zinc atom coordinated by three conserved residues contained within the consensus sequence HExxH, together with a conserved aspartate residue. The S2P/M50 family of RIP proteases is widely distributed; in eukaryotic cells, they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum (ER) stress responses. In sterol-depleted mammalian cells, a two-step proteolytic process releases the N-terminal domains of sterol regulatory element-bindin
Probab=33.76  E-value=26  Score=30.73  Aligned_cols=21  Identities=33%  Similarity=0.330  Sum_probs=15.6

Q ss_pred             hhhhhHHHHHHHHHHHh-cCCC
Q 019777          225 LTGSILAHEMMHAWLRL-KGYP  245 (336)
Q Consensus       225 ~~~~~lahe~~ha~l~~-~g~~  245 (336)
                      +.-+++.||++|++... -|.+
T Consensus         7 ~~i~i~iHE~gH~~~A~~~G~~   28 (180)
T cd05709           7 LLISVTVHELGHALVARRLGVK   28 (180)
T ss_pred             HHHHHHHHHHHHHHHHHHcCCC
Confidence            45689999999999544 4653


No 122
>PRK01345 heat shock protein HtpX; Provisional
Probab=33.57  E-value=31  Score=33.73  Aligned_cols=18  Identities=28%  Similarity=0.398  Sum_probs=14.8

Q ss_pred             CChhhhhhhHHHHHHHHH
Q 019777          221 LPRLLTGSILAHEMMHAW  238 (336)
Q Consensus       221 lp~~~~~~~lahe~~ha~  238 (336)
                      |..--..+|||||+.|.-
T Consensus       119 L~~dEL~aVlAHElgHi~  136 (317)
T PRK01345        119 LSPEEVAGVMAHELAHVK  136 (317)
T ss_pred             CCHHHHHHHHHHHHHHHH
Confidence            566667899999999975


No 123
>COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion]
Probab=33.33  E-value=19  Score=33.14  Aligned_cols=30  Identities=20%  Similarity=0.645  Sum_probs=22.8

Q ss_pred             CccCCCCccCCCCCceEEcCCCceeccchhhh
Q 019777           82 PRCCSCERMEPRDTKYLSLDDGRKLCLECLDS  113 (336)
Q Consensus        82 F~C~~C~~~l~~~~~f~~~~dG~~yC~~C~~~  113 (336)
                      -+|..|+..+. ..+ ....+|+++|..|+..
T Consensus       173 v~C~kCGE~~~-e~~-~~~~ng~~vC~~C~~~  202 (206)
T COG2191         173 VRCSKCGELFM-EPR-AVVLNGKPVCKPCAEK  202 (206)
T ss_pred             eeccccCcccc-cch-hhhcCCceeccccccc
Confidence            57999999885 333 3344999999999875


No 124
>PF04228 Zn_peptidase:  Putative neutral zinc metallopeptidase;  InterPro: IPR007343 Members of this family of bacterial proteins are described as hypothetical proteins or zinc metallopeptidases. The majority have a HExxH zinc-binding motif characteristic of neutral zinc metallopeptidases, however there is no evidence to support their function as metallopeptidases.
Probab=32.88  E-value=29  Score=33.65  Aligned_cols=46  Identities=22%  Similarity=0.200  Sum_probs=29.5

Q ss_pred             hhhhhhhHHHHHHHHHHHhcCCC----C----------CCcc-hhhhHHHHHHHHhhhccc
Q 019777          223 RLLTGSILAHEMMHAWLRLKGYP----N----------LRPD-VEEGICQVLAHMWLESEI  268 (336)
Q Consensus       223 ~~~~~~~lahe~~ha~l~~~g~~----~----------l~~~-veeg~cq~~a~~wl~~~~  268 (336)
                      .+..-.|||||+.|.-..|.|.-    .          +.+. .-|=-.+-+|=+|+..-.
T Consensus       167 ~~a~ayVlAHEyGHHVQ~l~Gil~~~~~~~~~~~~~~~~~~svr~ELQADC~AGvw~~~~~  227 (292)
T PF04228_consen  167 DFAQAYVLAHEYGHHVQNLLGILDAVRQAQQGRSPAEANELSVRLELQADCFAGVWAGHAA  227 (292)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhhHHHHHHHhhccCccccchHHHHHHHHHHHHHHHHhhhcc
Confidence            45566799999999999887731    1          1111 224455667888876643


No 125
>cd04327 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_like sub-family 3. A group of bacterial and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=32.86  E-value=26  Score=31.54  Aligned_cols=14  Identities=29%  Similarity=0.342  Sum_probs=11.4

Q ss_pred             hhhhhHHHHHHHHH
Q 019777          225 LTGSILAHEMMHAW  238 (336)
Q Consensus       225 ~~~~~lahe~~ha~  238 (336)
                      .+..++.||+|||-
T Consensus        91 ~~~~~i~HElgHaL  104 (198)
T cd04327          91 EFSRVVLHEFGHAL  104 (198)
T ss_pred             hHHHHHHHHHHHHh
Confidence            44568999999996


No 126
>COG4784 Putative Zn-dependent protease [General function prediction only]
Probab=32.31  E-value=21  Score=35.64  Aligned_cols=47  Identities=28%  Similarity=0.322  Sum_probs=32.1

Q ss_pred             EEEEecCCChhh-----hhhhHHHHHHHHHHHhcCCCCCCcchhhhHHHHHHH
Q 019777          214 AILILYGLPRLL-----TGSILAHEMMHAWLRLKGYPNLRPDVEEGICQVLAH  261 (336)
Q Consensus       214 ~ilvl~glp~~~-----~~~~lahe~~ha~l~~~g~~~l~~~veeg~cq~~a~  261 (336)
                      -|+|-.||=.|+     ..++|+|||.|+--+- |...-..+-||+|.--+..
T Consensus       107 YlYitRGLlAland~sEvAAVl~HEmgHVtAnH-gi~rQ~~e~a~~ia~rvva  158 (479)
T COG4784         107 YLYITRGLLALANDSSEVAAVLAHEMGHVTANH-GIQRQQREAAEVIASRVVA  158 (479)
T ss_pred             eEEEehhHHHHcCCHHHHHHHHHhhhhheecch-hHHHHHHHHHHHHHHHHHH
Confidence            467888876665     4579999999987654 5545556777777644333


No 127
>PRK01265 heat shock protein HtpX; Provisional
Probab=31.65  E-value=35  Score=33.62  Aligned_cols=24  Identities=29%  Similarity=0.277  Sum_probs=17.9

Q ss_pred             EEEEecC----CChhhhhhhHHHHHHHH
Q 019777          214 AILILYG----LPRLLTGSILAHEMMHA  237 (336)
Q Consensus       214 ~ilvl~g----lp~~~~~~~lahe~~ha  237 (336)
                      .|.|-.|    |.+--..+|||||++|.
T Consensus       124 ~Ivvt~gLl~~l~~~El~aVlAHElgHi  151 (324)
T PRK01265        124 RIAITLPLLKILNRDEIKAVAGHELGHL  151 (324)
T ss_pred             EEEEehHHHhhCCHHHHHHHHHHHHHHH
Confidence            3555555    56666789999999994


No 128
>PRK02391 heat shock protein HtpX; Provisional
Probab=31.65  E-value=21  Score=34.55  Aligned_cols=19  Identities=32%  Similarity=0.295  Sum_probs=15.4

Q ss_pred             CCChhhhhhhHHHHHHHHH
Q 019777          220 GLPRLLTGSILAHEMMHAW  238 (336)
Q Consensus       220 glp~~~~~~~lahe~~ha~  238 (336)
                      .|..--..+|||||++|.-
T Consensus       127 ~L~~~El~aVlaHElgHi~  145 (296)
T PRK02391        127 RLDPDELEAVLAHELSHVK  145 (296)
T ss_pred             hCCHHHHHHHHHHHHHHHH
Confidence            4666777899999999964


No 129
>cd06459 M3B_Oligoendopeptidase_F Peptidase family M3B Oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the PepF Bacillus amyloliquefaciens oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over expressed from a multicopy plasmid.
Probab=31.64  E-value=48  Score=32.86  Aligned_cols=38  Identities=26%  Similarity=0.259  Sum_probs=21.6

Q ss_pred             hhhhhhHHHHHHHHHHHh---cCCCCCCcchhhhHHHHHHH
Q 019777          224 LLTGSILAHEMMHAWLRL---KGYPNLRPDVEEGICQVLAH  261 (336)
Q Consensus       224 ~~~~~~lahe~~ha~l~~---~g~~~l~~~veeg~cq~~a~  261 (336)
                      .---..|+||++||+--+   ...+.+...+.-.+.++-|-
T Consensus       220 ~~~v~tl~HE~GHa~h~~~~~~~~~~~~~~~~~~~~E~~S~  260 (427)
T cd06459         220 LDDVFTLAHELGHAFHSYLSRDNQPYLYSDYPIFLAEIAST  260 (427)
T ss_pred             hhhHHHHHHHhhHHHHHHHHccCCCcccCCCCchhhHHHHH
Confidence            344467999999987332   23332444455555555443


No 130
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]
Probab=31.20  E-value=11  Score=40.76  Aligned_cols=46  Identities=20%  Similarity=0.496  Sum_probs=34.1

Q ss_pred             eeecCCCCCCCCCceeecCCccccccccccccC---CcCcccCCcccCCC
Q 019777           10 FRCHSCNLPITDVEFSMSGNRPYHKHCYKEQHH---PKCDVCQNFIPTNS   56 (336)
Q Consensus        10 F~C~~C~~~L~~~~F~~~dg~~yC~~CY~~~~~---pkC~~C~~~I~~~~   56 (336)
                      ++|..|+....+ .-..+-+..||..|-+.++.   .+|..|+.+...++
T Consensus       644 LkCs~Cn~R~Kd-~vI~kC~H~FC~~Cvq~r~etRqRKCP~Cn~aFganD  692 (698)
T KOG0978|consen  644 LKCSVCNTRWKD-AVITKCGHVFCEECVQTRYETRQRKCPKCNAAFGAND  692 (698)
T ss_pred             eeCCCccCchhh-HHHHhcchHHHHHHHHHHHHHhcCCCCCCCCCCCccc
Confidence            578889866554 23335578999999987654   47999999988775


No 131
>COG0501 HtpX Zn-dependent protease with chaperone function [Posttranslational modification, protein turnover, chaperones]
Probab=31.05  E-value=25  Score=33.11  Aligned_cols=18  Identities=33%  Similarity=0.281  Sum_probs=14.9

Q ss_pred             CChhhhhhhHHHHHHHHH
Q 019777          221 LPRLLTGSILAHEMMHAW  238 (336)
Q Consensus       221 lp~~~~~~~lahe~~ha~  238 (336)
                      |.+--.-+|||||++|.-
T Consensus       152 l~~dEl~aVlaHElgHi~  169 (302)
T COG0501         152 LNDDELEAVLAHELGHIK  169 (302)
T ss_pred             CCHHHHHHHHHHHHHHHh
Confidence            566667799999999975


No 132
>cd04282 ZnMc_meprin Zinc-dependent metalloprotease, meprin_like subfamily. Meprins are membrane-bound or secreted extracellular proteases, which cleave a variety of targets, including peptides such as parathyroid hormone, gastrin, and cholecystokinin, cytokines such as osteopontin, and proteins such as collagen IV, fibronectin, casein and gelatin. Meprins may also be able to release proteins from the cell surface. Closely related meprin alpha- and beta-subunits form homo- and hetero-oligomers; these complexes are found on epithelial cells of the intestine, for example, and are also expressed in certain cancer cells.
Probab=30.86  E-value=25  Score=32.97  Aligned_cols=12  Identities=33%  Similarity=0.637  Sum_probs=10.3

Q ss_pred             hhhHHHHHHHHH
Q 019777          227 GSILAHEMMHAW  238 (336)
Q Consensus       227 ~~~lahe~~ha~  238 (336)
                      -.+++||||||-
T Consensus       121 ~Gti~HEl~Hal  132 (230)
T cd04282         121 KATVEHEFLHAL  132 (230)
T ss_pred             CchHHHHHHHHh
Confidence            468999999996


No 133
>KOG3658 consensus Tumor necrosis factor-alpha-converting enzyme (TACE/ADAM17) and related metalloproteases [Extracellular structures]
Probab=30.79  E-value=18  Score=38.82  Aligned_cols=22  Identities=36%  Similarity=0.593  Sum_probs=17.7

Q ss_pred             ecC--CChhhhhhhHHHHHHHHHH
Q 019777          218 LYG--LPRLLTGSILAHEMMHAWL  239 (336)
Q Consensus       218 l~g--lp~~~~~~~lahe~~ha~l  239 (336)
                      -||  +|.=..--+||||+.|.|=
T Consensus       382 NYg~~Vp~kvs~lt~AHEiGHNfG  405 (764)
T KOG3658|consen  382 NYGKRVPTKVSDLTLAHEIGHNFG  405 (764)
T ss_pred             ecCCccCcchhheeehhhhccccC
Confidence            377  6666777889999999993


No 134
>cd04272 ZnMc_salivary_gland_MPs Zinc-dependent metalloprotease, salivary_gland_MPs. Metalloproteases secreted by the salivary glands of arthropods.
Probab=30.59  E-value=33  Score=31.27  Aligned_cols=15  Identities=20%  Similarity=0.275  Sum_probs=12.8

Q ss_pred             hhhhhhHHHHHHHHH
Q 019777          224 LLTGSILAHEMMHAW  238 (336)
Q Consensus       224 ~~~~~~lahe~~ha~  238 (336)
                      +....++|||++|..
T Consensus       143 ~~~~~~~AHElGH~l  157 (220)
T cd04272         143 YYGVYTMTHELAHLL  157 (220)
T ss_pred             cccHHHHHHHHHHHh
Confidence            466799999999986


No 135
>PF13583 Reprolysin_4:  Metallo-peptidase family M12B Reprolysin-like
Probab=30.39  E-value=26  Score=31.91  Aligned_cols=11  Identities=36%  Similarity=0.534  Sum_probs=10.0

Q ss_pred             hhHHHHHHHHH
Q 019777          228 SILAHEMMHAW  238 (336)
Q Consensus       228 ~~lahe~~ha~  238 (336)
                      .++|||++|++
T Consensus       139 ~~~aHEiGH~l  149 (206)
T PF13583_consen  139 QTFAHEIGHNL  149 (206)
T ss_pred             hHHHHHHHHHh
Confidence            66999999998


No 136
>cd04269 ZnMc_adamalysin_II_like Zinc-dependent metalloprotease; adamalysin_II_like subfamily. Adamalysin II is a snake venom zinc endopeptidase. This subfamily contains other snake venom metalloproteinases, as well as membrane-anchored metalloproteases belonging to the ADAM family. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions.
Probab=30.17  E-value=45  Score=29.50  Aligned_cols=16  Identities=38%  Similarity=0.451  Sum_probs=13.7

Q ss_pred             hhhhhhhHHHHHHHHH
Q 019777          223 RLLTGSILAHEMMHAW  238 (336)
Q Consensus       223 ~~~~~~~lahe~~ha~  238 (336)
                      .+.+..++|||++|.+
T Consensus       128 ~~~~a~~~AHElGH~l  143 (194)
T cd04269         128 LLLFAVTMAHELGHNL  143 (194)
T ss_pred             hHHHHHHHHHHHHhhc
Confidence            3677899999999986


No 137
>cd06160 S2P-M50_like_2 Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with additional putative N- and C-terminal transmembrane spanning regions, relative to the core protein, and no PDZ domains.
Probab=29.76  E-value=41  Score=30.27  Aligned_cols=24  Identities=25%  Similarity=0.146  Sum_probs=17.8

Q ss_pred             hhhhhhHHHHHHHHHHHh-cCCCCC
Q 019777          224 LLTGSILAHEMMHAWLRL-KGYPNL  247 (336)
Q Consensus       224 ~~~~~~lahe~~ha~l~~-~g~~~l  247 (336)
                      .++.+++.||++|++... .|.+.-
T Consensus        39 ~l~~~l~iHElgH~~~A~~~G~~~~   63 (183)
T cd06160          39 ALLAILGIHEMGHYLAARRHGVKAS   63 (183)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCcc
Confidence            356788999999999655 476533


No 138
>PF13582 Reprolysin_3:  Metallo-peptidase family M12B Reprolysin-like; PDB: 3P24_C.
Probab=29.76  E-value=26  Score=28.45  Aligned_cols=12  Identities=33%  Similarity=0.407  Sum_probs=10.5

Q ss_pred             hhhHHHHHHHHH
Q 019777          227 GSILAHEMMHAW  238 (336)
Q Consensus       227 ~~~lahe~~ha~  238 (336)
                      ..++|||+.|.+
T Consensus       108 ~~~~~HEiGH~l  119 (124)
T PF13582_consen  108 VDTFAHEIGHNL  119 (124)
T ss_dssp             TTHHHHHHHHHT
T ss_pred             ceEeeehhhHhc
Confidence            489999999975


No 139
>COG2738 Predicted Zn-dependent protease [General function prediction only]
Probab=29.63  E-value=27  Score=32.12  Aligned_cols=28  Identities=29%  Similarity=0.324  Sum_probs=22.4

Q ss_pred             ecCCChhhhhhhHHHHHHHHHHHhcCCC
Q 019777          218 LYGLPRLLTGSILAHEMMHAWLRLKGYP  245 (336)
Q Consensus       218 l~glp~~~~~~~lahe~~ha~l~~~g~~  245 (336)
                      -|+=|-+..-++.|||..||..-..+|+
T Consensus        84 ~y~g~Sia~~aVAAHEVGHAiQd~~~Y~  111 (226)
T COG2738          84 NYYGPSIAAIAVAAHEVGHAIQDQEDYA  111 (226)
T ss_pred             ccCCccHHHHHHHHHHhhHHHhhhcccH
Confidence            4666788888999999999987666654


No 140
>cd04283 ZnMc_hatching_enzyme Zinc-dependent metalloprotease, hatching enzyme-like subfamily. Hatching enzymes are secreted by teleost embryos to digest the egg envelope or chorion. In some teleosts, the hatching enzyme may be a system consisting of two evolutionary related  metalloproteases, high choriolytic enzyme and low choriolytic enzyme (HCE and LCE), which may have different  substrate specificities and cooperatively digest the chorion.
Probab=29.56  E-value=28  Score=31.37  Aligned_cols=12  Identities=42%  Similarity=0.800  Sum_probs=10.3

Q ss_pred             hhhHHHHHHHHH
Q 019777          227 GSILAHEMMHAW  238 (336)
Q Consensus       227 ~~~lahe~~ha~  238 (336)
                      -.+++||+|||-
T Consensus        78 ~G~i~HEl~HaL   89 (182)
T cd04283          78 KGIIQHELLHAL   89 (182)
T ss_pred             cchHHHHHHHHh
Confidence            468999999995


No 141
>PF02069 Metallothio_Pro:  Prokaryotic metallothionein;  InterPro: IPR000518 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium and nickel. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, , ]. An empirical classification into three classes was proposed by Kojima [], with class III MTs including atypical polypeptides composed of gamma-glutamylcysteinyl units. Class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. The MT superfamily is subdivided into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects [], e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range.  Family 14 consists of prokaryota MTs. Its members are recognised by the sequence pattern K-C-A-C-x(2)-C-L-C.The taxonomic range of the members extends to cyanobacteria. Known characteristics are: 53 to 56 AAs; 9 conserved Cys; one conserved tyrosine residue; one conserved histidine residue; contain other unusual residues. ; GO: 0046872 metal ion binding; PDB: 1JJD_A.
Probab=29.37  E-value=29  Score=25.05  Aligned_cols=28  Identities=21%  Similarity=0.490  Sum_probs=16.3

Q ss_pred             eecCCCCCCCCCceeecCCccccc-cccc
Q 019777           11 RCHSCNLPITDVEFSMSGNRPYHK-HCYK   38 (336)
Q Consensus        11 ~C~~C~~~L~~~~F~~~dg~~yC~-~CY~   38 (336)
                      -|..|...+....-+.+||+.||. .|-.
T Consensus         9 aC~~C~C~V~~~~Ai~~dGk~YCS~aCA~   37 (52)
T PF02069_consen    9 ACPSCSCVVSEEEAIQKDGKYYCSEACAN   37 (52)
T ss_dssp             SSTT----B-TTTSEESSS-EESSHHHHH
T ss_pred             cCCCCEeEECchHhHHhCCEeeecHHHhc
Confidence            367888888866778899999995 4543


No 142
>KOG1047 consensus Bifunctional leukotriene A4 hydrolase/aminopeptidase LTA4H [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones; Defense mechanisms; Amino acid transport and metabolism]
Probab=28.80  E-value=26  Score=36.96  Aligned_cols=13  Identities=38%  Similarity=0.946  Sum_probs=11.7

Q ss_pred             hhhHHHHHHHHHH
Q 019777          227 GSILAHEMMHAWL  239 (336)
Q Consensus       227 ~~~lahe~~ha~l  239 (336)
                      +.++|||++|.|-
T Consensus       289 ~~vIaHEIAHSWt  301 (613)
T KOG1047|consen  289 VDVIAHEIAHSWT  301 (613)
T ss_pred             hhHHHHHhhhhhc
Confidence            5899999999994


No 143
>TIGR02414 pepN_proteo aminopeptidase N, Escherichia coli type. The M1 family of zinc metallopeptidases contains a number of distinct, well-separated clades of proteins with aminopeptidase activity. Several are designated aminopeptidase N, EC 3.4.11.2, after the Escherichia coli enzyme, suggesting a similar activity profile. This family consists of all aminopeptidases closely related to E. coli PepN and presumed to have similar (not identical) function. Nearly all are found in Proteobacteria, but members are found also in Cyanobacteria, plants, and apicomplexan parasites. This family differs greatly in sequence from the family of aminopeptidases typified by Streptomyces lividans PepN (TIGR02412), from the membrane bound aminopeptidase N family in animals, etc.
Probab=28.44  E-value=48  Score=36.94  Aligned_cols=41  Identities=20%  Similarity=0.421  Sum_probs=26.7

Q ss_pred             hhhhHHHHHHHHHHHhc-CCCC-CCcchhhhHHHHHHHHhhhc
Q 019777          226 TGSILAHEMMHAWLRLK-GYPN-LRPDVEEGICQVLAHMWLES  266 (336)
Q Consensus       226 ~~~~lahe~~ha~l~~~-g~~~-l~~~veeg~cq~~a~~wl~~  266 (336)
                      ..+++|||+.|-|.-=. -.+. -...+-||+.-.+..+|.+.
T Consensus       283 i~~VIaHElaHqWfGNlVT~~~W~~LWLnEGfAty~e~~~~~~  325 (863)
T TIGR02414       283 IESVIAHEYFHNWTGNRVTCRDWFQLSLKEGLTVFRDQEFSAD  325 (863)
T ss_pred             HHHHHHHHHHHHHhcceeeecchhhhhhhhhHHHHHHHHHHHH
Confidence            35899999999995210 0111 12457999998888766543


No 144
>PRK09672 phage exclusion protein Lit; Provisional
Probab=28.21  E-value=69  Score=31.31  Aligned_cols=48  Identities=25%  Similarity=0.202  Sum_probs=37.0

Q ss_pred             CCChhhhhhhHHHHHHHHHHHhcCCCCCC-cchhhhHHHHHHHHhhhcc
Q 019777          220 GLPRLLTGSILAHEMMHAWLRLKGYPNLR-PDVEEGICQVLAHMWLESE  267 (336)
Q Consensus       220 glp~~~~~~~lahe~~ha~l~~~g~~~l~-~~veeg~cq~~a~~wl~~~  267 (336)
                      .|=-..++-|+.||+.|+.+-..++.... -.-||==|-..|--||-..
T Consensus       159 dLfl~A~a~i~~HEiaHv~~~h~~~~~~e~s~~eE~eaDs~At~~il~~  207 (305)
T PRK09672        159 DLFLCALAWILLHEIAHVEFQHSSLESNEDSIQEEKEADSYATNWLLSK  207 (305)
T ss_pred             HHHHHHHHHHHHHHHHHHHhccccccCchHHHHHHHHHHHHHHHHHHhc
Confidence            34456788999999999999998864444 3456777999999997653


No 145
>COG0308 PepN Aminopeptidase N [Amino acid transport and metabolism]
Probab=28.09  E-value=31  Score=38.34  Aligned_cols=38  Identities=26%  Similarity=0.504  Sum_probs=28.6

Q ss_pred             hHHHHHHHHHHH----hcCCCCCCcchhhhHHHHHHHHhhhccc
Q 019777          229 ILAHEMMHAWLR----LKGYPNLRPDVEEGICQVLAHMWLESEI  268 (336)
Q Consensus       229 ~lahe~~ha~l~----~~g~~~l~~~veeg~cq~~a~~wl~~~~  268 (336)
                      ++||||.|.|.-    ++-.  -...+-||+--++.+.|.+...
T Consensus       310 viaHElaHqWfGnlVT~~~W--~~lWLnEgfat~~e~~~~~~~~  351 (859)
T COG0308         310 VIAHELAHQWFGNLVTMKWW--DDLWLNEGFATFREVLWSEDLG  351 (859)
T ss_pred             HHHHHHhhhcccceeeccCH--HHHHHhhhhHHHHHHHHHHHhc
Confidence            999999999941    1111  2367889999999999987764


No 146
>KOG3314 consensus Ku70-binding protein [Replication, recombination and repair]
Probab=28.05  E-value=34  Score=30.64  Aligned_cols=16  Identities=25%  Similarity=0.538  Sum_probs=12.8

Q ss_pred             hhhhHHHHHHHHHHHh
Q 019777          226 TGSILAHEMMHAWLRL  241 (336)
Q Consensus       226 ~~~~lahe~~ha~l~~  241 (336)
                      ..-+++|||.|||=-+
T Consensus        91 ~n~vv~HElIH~fDd~  106 (194)
T KOG3314|consen   91 VNQVVIHELIHAFDDC  106 (194)
T ss_pred             HHHHHHHHHHHHHHhh
Confidence            4568999999999554


No 147
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=27.45  E-value=34  Score=23.46  Aligned_cols=14  Identities=36%  Similarity=0.930  Sum_probs=10.9

Q ss_pred             eeecCCCCCCCCCc
Q 019777           10 FRCHSCNLPITDVE   23 (336)
Q Consensus        10 F~C~~C~~~L~~~~   23 (336)
                      |+|..|+++|.+..
T Consensus         1 ~~C~~C~~~i~g~r   14 (46)
T cd02249           1 YSCDGCLKPIVGVR   14 (46)
T ss_pred             CCCcCCCCCCcCCE
Confidence            57899999887743


No 148
>PF13834 DUF4193:  Domain of unknown function (DUF4193)
Probab=27.42  E-value=21  Score=29.16  Aligned_cols=31  Identities=23%  Similarity=0.574  Sum_probs=20.1

Q ss_pred             CCCCccCCCCccCCCCCceEEcCCCceeccch
Q 019777           79 DGTPRCCSCERMEPRDTKYLSLDDGRKLCLEC  110 (336)
Q Consensus        79 ~~CF~C~~C~~~l~~~~~f~~~~dG~~yC~~C  110 (336)
                      ..=|.|.+|-..-- ..+-....+|.++|..|
T Consensus        68 ~DEFTCssCFLV~H-RSqLa~~~~g~~iC~DC   98 (99)
T PF13834_consen   68 ADEFTCSSCFLVHH-RSQLAREKDGQPICRDC   98 (99)
T ss_pred             CCceeeeeeeeEec-hhhhccccCCCEecccc
Confidence            34499999975432 22222344899999998


No 149
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=27.36  E-value=38  Score=32.60  Aligned_cols=16  Identities=13%  Similarity=0.513  Sum_probs=12.8

Q ss_pred             CCCeeecCCCCCCCCC
Q 019777            7 PECFRCHSCNLPITDV   22 (336)
Q Consensus         7 ~~CF~C~~C~~~L~~~   22 (336)
                      ...++|..|++..+..
T Consensus       128 ~~r~~c~eCgk~ysT~  143 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTS  143 (279)
T ss_pred             CCceeccccccccccc
Confidence            3478999999998763


No 150
>cd06461 M2_ACE Peptidase family M2 Angiotensin converting enzyme (ACE, EC 3.4.15.1) is a membrane-bound, zinc dependent dipeptidase that catalyzes the conversion of the decapeptide angiotensin I to the potent vasopressor ocatapeptide angiotensin II, by removing two C-terminal amino acids. There are two forms of the enzyme in humans, the ubiquitous somatic ACE and the sperm-specific germinal ACE, both encoded by the same gene through transcription from alternative promoters. Somatic ACE has two tandem active sites with distinct catalytic properties, whereas germinal ACE, the function of which is largely unknown, has just a single active site. Recently, an ACE homolog, ACE2, has been identified in humans that differs from ACE; it preferentially removes carboxy-terminal hydrophobic or basic amino acids and appears to be important in cardiac function. ACE homologs (also known as members of the M2 gluzincin family) have been found in a wide variety of species, including those that neither h
Probab=27.12  E-value=58  Score=33.81  Aligned_cols=34  Identities=26%  Similarity=0.370  Sum_probs=23.4

Q ss_pred             hHHHHHHHHHHHhcCCCCCC--------cchhhhHHHHHHHHh
Q 019777          229 ILAHEMMHAWLRLKGYPNLR--------PDVEEGICQVLAHMW  263 (336)
Q Consensus       229 ~lahe~~ha~l~~~g~~~l~--------~~veeg~cq~~a~~w  263 (336)
                      ++-|||+||+.-+. |++++        |...|-+|+++|..-
T Consensus       250 t~~HE~GH~~yy~~-y~~~p~~~r~~anp~fheav~e~~smS~  291 (477)
T cd06461         250 TVHHEMGHIQYYLQ-YKDQPVLFREGANPGFHEAVGDAIALSV  291 (477)
T ss_pred             HHHHHHHHHHHHHH-hccCCHHHhCCCCCChHHHHHHHHHHhc
Confidence            46699999986544 44443        555668899987654


No 151
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=26.41  E-value=39  Score=20.46  Aligned_cols=21  Identities=24%  Similarity=0.504  Sum_probs=11.2

Q ss_pred             ccCCCCccCCCCCceEEcCCCceeccchhh
Q 019777           83 RCCSCERMEPRDTKYLSLDDGRKLCLECLD  112 (336)
Q Consensus        83 ~C~~C~~~l~~~~~f~~~~dG~~yC~~C~~  112 (336)
                      .|..|+..++         ++..||..|-.
T Consensus         4 ~Cp~Cg~~~~---------~~~~fC~~CG~   24 (26)
T PF13248_consen    4 FCPNCGAEID---------PDAKFCPNCGA   24 (26)
T ss_pred             CCcccCCcCC---------cccccChhhCC
Confidence            3666666543         34455666643


No 152
>TIGR00181 pepF oligoendopeptidase F. This family represents the oligoendopeptidase F clade of the family of larger M3 or thimet (for thiol-dependent metallopeptidase) oligopeptidase family. Lactococcus lactis PepF hydrolyzed peptides of 7 and 17 amino acids with fairly broad specificity. The homolog of lactococcal PepF in group B Streptococcus was named PepB (PubMed:8757883), with the name difference reflecting a difference in species of origin rather activity; substrate profiles were quite similar. Differences in substrate specificity should be expected in other species. The gene is duplicated in Lactococcus lactis on the plasmid that bears it. A shortened second copy is found in Bacillus subtilis.
Probab=26.31  E-value=32  Score=36.15  Aligned_cols=16  Identities=38%  Similarity=0.355  Sum_probs=12.9

Q ss_pred             hhhhhhhHHHHHHHHH
Q 019777          223 RLLTGSILAHEMMHAW  238 (336)
Q Consensus       223 ~~~~~~~lahe~~ha~  238 (336)
                      .+---.+||||++||+
T Consensus       375 ~~~dv~TLaHElGHa~  390 (591)
T TIGR00181       375 TLNSVFTLAHELGHSM  390 (591)
T ss_pred             CcchHHHHHHHhhhHH
Confidence            3455689999999998


No 153
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=26.10  E-value=58  Score=21.21  Aligned_cols=36  Identities=19%  Similarity=0.499  Sum_probs=22.1

Q ss_pred             cCCCCccCCCCCceEEcCCCceeccchhhhcccCCCCC
Q 019777           84 CCSCERMEPRDTKYLSLDDGRKLCLECLDSAIMDTHEC  121 (336)
Q Consensus        84 C~~C~~~l~~~~~f~~~~dG~~yC~~C~~~~v~~~~~C  121 (336)
                      |..|...+.  ...+...=|..||.+|..+.+.....|
T Consensus         1 C~iC~~~~~--~~~~~~~CGH~fC~~C~~~~~~~~~~C   36 (39)
T PF13923_consen    1 CPICLDELR--DPVVVTPCGHSFCKECIEKYLEKNPKC   36 (39)
T ss_dssp             ETTTTSB-S--SEEEECTTSEEEEHHHHHHHHHCTSB-
T ss_pred             CCCCCCccc--CcCEECCCCCchhHHHHHHHHHCcCCC
Confidence            456666553  354456679999999988764443333


No 154
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein. Putative zinc-binding domain present in dystrophin-like proteins,  and CREB-binding protein/p300 homologues. The ZZ in dystrophin appears to bind calmodulin. A missense mutation of one of the conserved cysteines in dystrophin results in a patient with Duchenne muscular dystrophy [3].
Probab=25.42  E-value=41  Score=22.90  Aligned_cols=30  Identities=20%  Similarity=0.702  Sum_probs=18.2

Q ss_pred             eeecCCCCCCCCCceee--cCCcccccccccc
Q 019777           10 FRCHSCNLPITDVEFSM--SGNRPYHKHCYKE   39 (336)
Q Consensus        10 F~C~~C~~~L~~~~F~~--~dg~~yC~~CY~~   39 (336)
                      +.|..|+++|.+..|.-  =.+--+|.+||.+
T Consensus         5 ~~C~~C~~~i~g~ry~C~~C~d~dlC~~Cf~~   36 (44)
T smart00291        5 YSCDTCGKPIVGVRYHCLVCPDYDLCQSCFAK   36 (44)
T ss_pred             cCCCCCCCCCcCCEEECCCCCCccchHHHHhC
Confidence            45788888887765531  1234556666653


No 155
>cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family. MMPs are responsible for a great deal of pericellular proteolysis of extracellular matrix and cell surface molecules, playing crucial roles in morphogenesis, cell fate specification, cell migration, tissue repair, tumorigenesis, gain or loss of tissue-specific functions, and apoptosis. In many instances, they are anchored to cell membranes via trans-membrane domains, and their activity is controlled via TIMPs (tissue inhibitors of metalloproteinases).
Probab=25.05  E-value=34  Score=29.35  Aligned_cols=16  Identities=38%  Similarity=0.191  Sum_probs=13.2

Q ss_pred             ChhhhhhhHHHHHHHH
Q 019777          222 PRLLTGSILAHEMMHA  237 (336)
Q Consensus       222 p~~~~~~~lahe~~ha  237 (336)
                      +..-.-.|+.||+.||
T Consensus       103 ~~~~~~~~~~HEiGHa  118 (157)
T cd04278         103 GGTDLFSVAAHEIGHA  118 (157)
T ss_pred             ccchHHHHHHHHhccc
Confidence            3455778999999999


No 156
>PF05572 Peptidase_M43:  Pregnancy-associated plasma protein-A;  InterPro: IPR008754 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase M43 (cytophagalysin family, clan MA(M)), subfamily M43. The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH. The type example of this family is the pregnancy-associated plasma protein A (PAPP-A), which cleaves insulin-like growth factor (IGF) binding protein-4 (IGFBP-4), causing a dramatic reduction in its affinity for IGF-I and -II. Through this mechanism, PAPP-A is a regulator of IGF bioactivity in several systems, including the Homo sapiens ovary and the cardiovascular system [, , , ].; PDB: 3LUN_A 3LUM_B 2J83_A 2CKI_A.
Probab=25.01  E-value=39  Score=29.49  Aligned_cols=19  Identities=42%  Similarity=0.742  Sum_probs=13.9

Q ss_pred             ChhhhhhhHHHHHHHHHHHh
Q 019777          222 PRLLTGSILAHEMMHAWLRL  241 (336)
Q Consensus       222 p~~~~~~~lahe~~ha~l~~  241 (336)
                      +....|.+|+||++| ||-|
T Consensus        65 ~~~~~g~TltHEvGH-~LGL   83 (154)
T PF05572_consen   65 SQYNFGKTLTHEVGH-WLGL   83 (154)
T ss_dssp             TTS-SSHHHHHHHHH-HTT-
T ss_pred             Cccccccchhhhhhh-hhcc
Confidence            366779999999999 5555


No 157
>PRK11595 DNA utilization protein GntX; Provisional
Probab=24.80  E-value=46  Score=30.66  Aligned_cols=37  Identities=16%  Similarity=0.385  Sum_probs=23.0

Q ss_pred             eecCCCCCCCCCceeecCCcccccccccccc--CCcCcccCCccc
Q 019777           11 RCHSCNLPITDVEFSMSGNRPYHKHCYKEQH--HPKCDVCQNFIP   53 (336)
Q Consensus        11 ~C~~C~~~L~~~~F~~~dg~~yC~~CY~~~~--~pkC~~C~~~I~   53 (336)
                      +|..|++++...      ....|..|...+.  .+.|..|+.++.
T Consensus         7 ~C~~C~~~~~~~------~~~lC~~C~~~l~~~~~~C~~Cg~~~~   45 (227)
T PRK11595          7 LCWLCRMPLALS------HWGICSVCSRALRTLKTCCPQCGLPAT   45 (227)
T ss_pred             cCccCCCccCCC------CCcccHHHHhhCCcccCcCccCCCcCC
Confidence            366777777432      1247888876542  356888887643


No 158
>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site. Members of this family may have an amino terminal propeptide, which is cleaved to yield the active protease domain, which is consequently always found at the N-terminus in multi-domain architectures. This family includes: astacin, a digestive enzyme from Crayfish; meprin, a multiple domain membrane component that is constructed from a homologous alpha and beta chain, proteins involved in (bone) morphogenesis, tolloid from drosophila, and the sea urchin SPAN protein, which may also play a role in development.
Probab=24.73  E-value=36  Score=30.21  Aligned_cols=12  Identities=42%  Similarity=0.631  Sum_probs=10.1

Q ss_pred             hhhHHHHHHHHH
Q 019777          227 GSILAHEMMHAW  238 (336)
Q Consensus       227 ~~~lahe~~ha~  238 (336)
                      -.++.||+|||-
T Consensus        75 ~g~v~HE~~Hal   86 (180)
T cd04280          75 LGTIVHELMHAL   86 (180)
T ss_pred             CchhHHHHHHHh
Confidence            368899999994


No 159
>PF07607 DUF1570:  Protein of unknown function (DUF1570);  InterPro: IPR011464 This entry represents hypothetical proteins confined to bacteria.
Probab=24.32  E-value=85  Score=26.72  Aligned_cols=32  Identities=28%  Similarity=0.402  Sum_probs=23.9

Q ss_pred             hhHHHHHHHHHHHhcCC-C---CCCcchhhhHHHHH
Q 019777          228 SILAHEMMHAWLRLKGY-P---NLRPDVEEGICQVL  259 (336)
Q Consensus       228 ~~lahe~~ha~l~~~g~-~---~l~~~veeg~cq~~  259 (336)
                      +.++||..|-=+.--|. +   .-|..|-|||...+
T Consensus         3 ~T~~HEa~HQl~~N~Gl~~r~~~~P~Wv~EGlA~yF   38 (128)
T PF07607_consen    3 ATIAHEATHQLAFNTGLHPRLADWPRWVSEGLATYF   38 (128)
T ss_pred             hHHHHHHHHHHHHHccccccCCCCchHHHHhHHHHc
Confidence            67999999988777673 3   44567888887655


No 160
>PF11928 DUF3446:  Domain of unknown function (DUF3446);  InterPro: IPR021849  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 80 to 99 amino acids in length. This domain is found associated with PF00096 from PFAM. This domain has a single completely conserved residue P that may be functionally important. 
Probab=24.12  E-value=85  Score=24.92  Aligned_cols=9  Identities=22%  Similarity=0.346  Sum_probs=6.5

Q ss_pred             hhhHHHHHH
Q 019777          252 EEGICQVLA  260 (336)
Q Consensus       252 eeg~cq~~a  260 (336)
                      -|||=+++.
T Consensus        17 ~E~iislvS   25 (84)
T PF11928_consen   17 PEPIISLVS   25 (84)
T ss_pred             cchhHHHhh
Confidence            677777776


No 161
>PHA02624 large T antigen; Provisional
Probab=23.85  E-value=1.6e+02  Score=31.87  Aligned_cols=23  Identities=30%  Similarity=0.375  Sum_probs=19.7

Q ss_pred             CCchHHHHHHHHHhhhhhcCCCC
Q 019777          302 KRSDFEKDLGKFFKHQIESDTSS  324 (336)
Q Consensus       302 ~~~~~~~~l~~~~~~~i~~d~s~  324 (336)
                      ++.+|-.-|.+|+.+.|-++..+
T Consensus       149 ~p~dfp~~L~~flS~Ai~sNkt~  171 (647)
T PHA02624        149 APNDFPSCLLAFLSHAIFSNKTL  171 (647)
T ss_pred             ChhhhHHHHHHHHHHHHhhcCCC
Confidence            67799999999999999877653


No 162
>PF12156 ATPase-cat_bd:  Putative metal-binding domain of cation transport ATPase;  InterPro: IPR021993  This domain is found in bacteria, and is approximately 90 amino acids in length. It is found associated with PF00403 from PFAM, PF00122 from PFAM, PF00702 from PFAM. The cysteine-rich nature and composition suggest this might be a cation-binding domain; most members are annotated as being cation transport ATPases. 
Probab=23.42  E-value=54  Score=25.89  Aligned_cols=10  Identities=40%  Similarity=0.810  Sum_probs=5.8

Q ss_pred             cCcccCCccc
Q 019777           44 KCDVCQNFIP   53 (336)
Q Consensus        44 kC~~C~~~I~   53 (336)
                      .|..|+.+|+
T Consensus         2 ~C~HCg~~~p   11 (88)
T PF12156_consen    2 KCYHCGLPVP   11 (88)
T ss_pred             CCCCCCCCCC
Confidence            3556666664


No 163
>COG2835 Uncharacterized conserved protein [Function unknown]
Probab=23.40  E-value=61  Score=24.12  Aligned_cols=40  Identities=18%  Similarity=0.420  Sum_probs=25.3

Q ss_pred             CccCCCCccCCCCCceEEcCCCceeccchhhhcccCCCCCCchhhHHHHHHhhccceeccccccchhc
Q 019777           82 PRCCSCERMEPRDTKYLSLDDGRKLCLECLDSAIMDTHECQPLYLEIQEFYEGLNMKVEQQVPLLLVE  149 (336)
Q Consensus        82 F~C~~C~~~l~~~~~f~~~~dG~~yC~~C~~~~v~~~~~C~~c~~~I~~f~~glg~~i~~~~p~~lV~  149 (336)
                      ..|-.|+-+|.     +..+.+.++|..|...                       -||.+.+|++|.+
T Consensus         9 LaCP~~kg~L~-----~~~~~~~L~c~~~~~a-----------------------YpI~dGIPvlL~~   48 (60)
T COG2835           9 LACPVCKGPLV-----YDEEKQELICPRCKLA-----------------------YPIRDGIPVLLPD   48 (60)
T ss_pred             eeccCcCCcce-----EeccCCEEEecccCce-----------------------eecccCccccCch
Confidence            34666665553     2333556777777443                       5788999998864


No 164
>PRK12495 hypothetical protein; Provisional
Probab=23.31  E-value=39  Score=31.53  Aligned_cols=25  Identities=20%  Similarity=0.509  Sum_probs=16.0

Q ss_pred             CCeeecCCCCCCCCCceeecCCcccccccc
Q 019777            8 ECFRCHSCNLPITDVEFSMSGNRPYHKHCY   37 (336)
Q Consensus         8 ~CF~C~~C~~~L~~~~F~~~dg~~yC~~CY   37 (336)
                      --|.|..|+.||.     ...|..+|..|-
T Consensus        41 sa~hC~~CG~PIp-----a~pG~~~Cp~CQ   65 (226)
T PRK12495         41 TNAHCDECGDPIF-----RHDGQEFCPTCQ   65 (226)
T ss_pred             chhhcccccCccc-----CCCCeeECCCCC
Confidence            3467888888885     236666555554


No 165
>cd06163 S2P-M50_PDZ_RseP-like RseP-like Site-2 proteases (S2P), zinc metalloproteases (MEROPS family M50A), cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. In Escherichia coli, the S2P homolog RseP is involved in the sigmaE pathway of extracytoplasmic stress responses. Also included in this group are such homologs as Bacillus subtilis YluC, Mycobacterium tuberculosis Rv2869c S2P, and Bordetella bronchiseptica HurP.  Rv2869c S2P appears to have a role in the regulation of prokaryotic lipid biosynthesis and membrane composition and YluC of Bacillus has a role in transducing membrane stress. This group includes bacterial and eukaryotic S2P/M50s homologs with either one or two PDZ domains present. PDZ domains are believed to have a regulatory role. The RseP PDZ domain is required for the inhibitory reaction that prevents cleavage of its substrate, RseA.
Probab=22.84  E-value=54  Score=29.47  Aligned_cols=21  Identities=29%  Similarity=0.240  Sum_probs=15.9

Q ss_pred             hhhhhHHHHHHHHHHHh-cCCC
Q 019777          225 LTGSILAHEMMHAWLRL-KGYP  245 (336)
Q Consensus       225 ~~~~~lahe~~ha~l~~-~g~~  245 (336)
                      +..+++-||+.|.|... .|.+
T Consensus         8 l~~~v~iHElGH~~~Ar~~Gv~   29 (182)
T cd06163           8 LGILIFVHELGHFLVAKLFGVK   29 (182)
T ss_pred             HHHHHHHHHHHHHHHHHHcCCe
Confidence            56689999999999654 3653


No 166
>KOG2661 consensus Peptidase family M48 [Posttranslational modification, protein turnover, chaperones]
Probab=22.56  E-value=55  Score=32.64  Aligned_cols=27  Identities=30%  Similarity=0.482  Sum_probs=18.5

Q ss_pred             EEEecC-CChh----hhhhhHHHHHHHHHHHh
Q 019777          215 ILILYG-LPRL----LTGSILAHEMMHAWLRL  241 (336)
Q Consensus       215 ilvl~g-lp~~----~~~~~lahe~~ha~l~~  241 (336)
                      |.|..| ||..    -...+||||++||-.|-
T Consensus       259 vfVFtgiLn~ck~ddglAtvLgHE~aHaVarH  290 (424)
T KOG2661|consen  259 VFVFTGILNSCKDDDGLATVLGHEIAHAVARH  290 (424)
T ss_pred             EEEEechhhcccChHHHHHHHHHHHHHHHHHH
Confidence            345555 4432    24579999999998885


No 167
>PF04570 DUF581:  Protein of unknown function (DUF581);  InterPro: IPR007650 This is a family of uncharacterised proteins.
Probab=22.41  E-value=54  Score=24.19  Aligned_cols=30  Identities=17%  Similarity=0.485  Sum_probs=20.5

Q ss_pred             cCCCCccCCCCCceEEcCCCceec-cchhhh
Q 019777           84 CCSCERMEPRDTKYLSLDDGRKLC-LECLDS  113 (336)
Q Consensus        84 C~~C~~~l~~~~~f~~~~dG~~yC-~~C~~~  113 (336)
                      |.-|++.|..+...++..+.+.+| .+|-..
T Consensus        19 C~~C~k~L~~~~DiymYrGd~aFCS~ECR~~   49 (58)
T PF04570_consen   19 CYLCKKKLDPGKDIYMYRGDKAFCSEECRSQ   49 (58)
T ss_pred             HHccCCCCCCCCCeeeeccccccccHHHHHH
Confidence            777888887666666666777888 346544


No 168
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=22.22  E-value=43  Score=21.83  Aligned_cols=11  Identities=27%  Similarity=1.005  Sum_probs=8.5

Q ss_pred             eeecCCCCCCC
Q 019777           10 FRCHSCNLPIT   20 (336)
Q Consensus        10 F~C~~C~~~L~   20 (336)
                      |+|..|+..+.
T Consensus         6 y~C~~Cg~~fe   16 (41)
T smart00834        6 YRCEDCGHTFE   16 (41)
T ss_pred             EEcCCCCCEEE
Confidence            68888888664


No 169
>COG3590 PepO Predicted metalloendopeptidase [Posttranslational modification, protein turnover, chaperones]
Probab=21.81  E-value=23  Score=37.46  Aligned_cols=16  Identities=25%  Similarity=0.549  Sum_probs=13.3

Q ss_pred             hhhhHHHHHHHHHHHh
Q 019777          226 TGSILAHEMMHAWLRL  241 (336)
Q Consensus       226 ~~~~lahe~~ha~l~~  241 (336)
                      -|+|.+|||.|+|=-.
T Consensus       487 IGaVIgHEI~HgFDdq  502 (654)
T COG3590         487 IGAVIGHEIGHGFDDQ  502 (654)
T ss_pred             ccceehhhhcccccCC
Confidence            4899999999999544


No 170
>PF09471 Peptidase_M64:  IgA Peptidase M64;  InterPro: IPR019026 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases [].  This is a family of highly selective metallo-endopeptidases belonging to the MEROPS peptidase family M64 (IgA peptidase, clan MA). The primary structure of the Clostridium ramosum IgA peptidase shows no significant overall similarity to any other known metallo-endopeptidase []. ; PDB: 3P1V_A 4DF9_D.
Probab=21.28  E-value=47  Score=31.75  Aligned_cols=18  Identities=22%  Similarity=0.305  Sum_probs=14.3

Q ss_pred             hhhhhHHHHHHHHHHHhc
Q 019777          225 LTGSILAHEMMHAWLRLK  242 (336)
Q Consensus       225 ~~~~~lahe~~ha~l~~~  242 (336)
                      .+..|+.||++|.+..|.
T Consensus       215 ~~~~v~vHE~GHsf~~La  232 (264)
T PF09471_consen  215 SFKQVVVHEFGHSFGGLA  232 (264)
T ss_dssp             THHHHHHHHHHHHTT---
T ss_pred             cccceeeeeccccccccc
Confidence            788999999999999995


No 171
>PF12725 DUF3810:  Protein of unknown function (DUF3810);  InterPro: IPR024294 This family of bacterial proteins is functionally uncharacterised. Proteins in this family are typically between 333 and 377 amino acids in length and contain a conserved HEXXH sequence motif that is characteristic of metallopeptidases. This family may therefore belong to an as yet uncharacterised family of peptidase enzymes.
Probab=21.21  E-value=50  Score=32.30  Aligned_cols=34  Identities=24%  Similarity=0.370  Sum_probs=24.7

Q ss_pred             CCChhhhhhhHHHHHHHHHHHhcCCCCCCcchhhhHHHHHHHHh
Q 019777          220 GLPRLLTGSILAHEMMHAWLRLKGYPNLRPDVEEGICQVLAHMW  263 (336)
Q Consensus       220 glp~~~~~~~lahe~~ha~l~~~g~~~l~~~veeg~cq~~a~~w  263 (336)
                      .+|.+..-.++||||+|-    .||      .-|.=|+.+|++-
T Consensus       190 ~~p~~~~P~T~~HElAHq----~G~------a~E~EANFiayLa  223 (318)
T PF12725_consen  190 DLPPYSLPFTICHELAHQ----LGF------ASEDEANFIAYLA  223 (318)
T ss_pred             CCCcccccHHHHHHHHHH----hCC------CCHHHHHHHHHHH
Confidence            488899999999999993    354      2355566666665


No 172
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=21.17  E-value=47  Score=22.46  Aligned_cols=12  Identities=25%  Similarity=0.816  Sum_probs=9.3

Q ss_pred             eeecCCCCCCCC
Q 019777           10 FRCHSCNLPITD   21 (336)
Q Consensus        10 F~C~~C~~~L~~   21 (336)
                      |+|..|+..+..
T Consensus         6 y~C~~Cg~~fe~   17 (42)
T PF09723_consen    6 YRCEECGHEFEV   17 (42)
T ss_pred             EEeCCCCCEEEE
Confidence            789999877754


No 173
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only]
Probab=21.14  E-value=50  Score=35.47  Aligned_cols=17  Identities=12%  Similarity=-0.116  Sum_probs=12.9

Q ss_pred             hhhhhcCCCCCCchhhh
Q 019777          315 KHQIESDTSSAYGDGLG  331 (336)
Q Consensus       315 ~~~i~~d~s~~yg~gfr  331 (336)
                      +..+..|.|..|=++.+
T Consensus       483 ~~~s~~~~s~~~v~~~~  499 (694)
T KOG4443|consen  483 KPNSAVQISEPGVGSEA  499 (694)
T ss_pred             cCCcccccccccccccc
Confidence            46778888888877765


No 174
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=21.05  E-value=84  Score=29.51  Aligned_cols=54  Identities=13%  Similarity=0.362  Sum_probs=36.5

Q ss_pred             CCeeecCCCCCCCCCceeecCCcccccccccc-----ccCCcCcccCCcccCCCCceEEEee
Q 019777            8 ECFRCHSCNLPITDVEFSMSGNRPYHKHCYKE-----QHHPKCDVCQNFIPTNSAGLIEYRA   64 (336)
Q Consensus         8 ~CF~C~~C~~~L~~~~F~~~dg~~yC~~CY~~-----~~~pkC~~C~~~I~~~~~g~i~~~~   64 (336)
                      .+|-|..|=. ++...-..-=|.+||=.|..+     .....|.+|+-.|..+.  +|-..+
T Consensus        46 ~~FdCNICLd-~akdPVvTlCGHLFCWpClyqWl~~~~~~~~cPVCK~~Vs~~~--vvPlYG  104 (230)
T KOG0823|consen   46 GFFDCNICLD-LAKDPVVTLCGHLFCWPCLYQWLQTRPNSKECPVCKAEVSIDT--VVPLYG  104 (230)
T ss_pred             Cceeeeeecc-ccCCCEEeecccceehHHHHHHHhhcCCCeeCCccccccccce--EEeeec
Confidence            4788888833 333345556789999999865     34456899999888753  554444


No 175
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=20.59  E-value=65  Score=19.92  Aligned_cols=12  Identities=42%  Similarity=0.908  Sum_probs=6.8

Q ss_pred             CcCcccCCcccC
Q 019777           43 PKCDVCQNFIPT   54 (336)
Q Consensus        43 pkC~~C~~~I~~   54 (336)
                      .+|..|...|..
T Consensus         2 ~~C~rC~~~~~~   13 (30)
T PF06827_consen    2 EKCPRCWNYIED   13 (30)
T ss_dssp             SB-TTT--BBEE
T ss_pred             CcCccCCCcceE
Confidence            478888888875


No 176
>cd06258 Peptidase_M3_like The peptidase M3-like family, also called neurolysin-like family, is part of the "zincins" metallopeptidases, and includes M3, M2 and M32 families of metallopeptidases.  The M3 family is subdivided into two subfamilies: the widespread M3A, which comprises a number of high-molecular mass endo- and exopeptidases from bacteria, archaea, protozoa, fungi, plants and animals, and the small M3B, whose members are enzymes primarily from bacteria. Well-known mammalian/eukaryotic M3A endopeptidases are the thimet oligopeptidase (TOP; endopeptidase 3.4.24.15), neurolysin (alias endopeptidase 3.4.24.16), and the mitochondrial intermediate peptidase. The first two are intracellular oligopeptidases, which act only on relatively short substrates of less than 20 amino acid residues, while the latter cleaves N-terminal octapeptides from proteins during their import into the mitochondria. The M3A subfamily also contains several bacterial endopeptidases, collectively called olig
Probab=20.31  E-value=1.5e+02  Score=28.96  Aligned_cols=32  Identities=28%  Similarity=0.318  Sum_probs=18.7

Q ss_pred             hhHHHHHHHHHHHh--c-CCCC-CCcchhhhHHHHH
Q 019777          228 SILAHEMMHAWLRL--K-GYPN-LRPDVEEGICQVL  259 (336)
Q Consensus       228 ~~lahe~~ha~l~~--~-g~~~-l~~~veeg~cq~~  259 (336)
                      ..|+||++||.--+  + .++. +...++-++.++.
T Consensus       156 ~tl~HE~GHa~h~~l~~~~~~~~~g~~~~~~~~E~~  191 (365)
T cd06258         156 NTLFHEFGHAVHFLLIQQRYPFQERTPTSTDFAEAQ  191 (365)
T ss_pred             HHHHHHHhHHHHHHHhcCCCCcCCCCCCCccHHhcc
Confidence            56999999999443  2 3443 3244555555543


No 177
>PF01432 Peptidase_M3:  Peptidase family M3 This Prosite motif covers only the active site. This family belongs to family M3 of the peptidase classification.;  InterPro: IPR001567 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M3 (clan MA(E)), subfamilies M3A and M3B. The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. The Thimet oligopeptidase family, is a large family of archaeal, bacterial and eukaryotic oligopeptidases that cleave medium sized peptides. The group contains:  mitochondrial intermediate peptidase (3.4.24.59 from EC) Neurolysin, mitochondrial precursor, (3.4.24.16 from EC) Thimet oligopeptidase (3.4.24.15 from EC) Dipeptidyl carboxypeptidase (3.4.15.5 from EC) Oligopeptidase A (3.4.24.70 from EC) Oligoendopeptidase F ; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2QR4_B 3CE2_A 1Y79_1 2H1J_A 2H1N_A 2O36_A 1S4B_P 2O3E_A 1I1I_P.
Probab=20.21  E-value=1.6e+02  Score=29.75  Aligned_cols=16  Identities=38%  Similarity=0.314  Sum_probs=13.2

Q ss_pred             hhhhHHHHHHHHHHHh
Q 019777          226 TGSILAHEMMHAWLRL  241 (336)
Q Consensus       226 ~~~~lahe~~ha~l~~  241 (336)
                      --..|+||++||+--+
T Consensus       242 ~v~tLfHE~GHa~H~~  257 (458)
T PF01432_consen  242 DVETLFHEFGHAMHSL  257 (458)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHhHHHHHH
Confidence            4678999999999555


No 178
>cd02336 ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present in RSC8 and related proteins. RSC8 is a component of the RSC complex, which is closely related to the SWI/SNF complex and is involved in remodeling chromatin structure. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=20.08  E-value=86  Score=21.79  Aligned_cols=30  Identities=23%  Similarity=0.610  Sum_probs=17.9

Q ss_pred             ccCCCCccCCCCCceEEcCC-Cceeccchhhh
Q 019777           83 RCCSCERMEPRDTKYLSLDD-GRKLCLECLDS  113 (336)
Q Consensus        83 ~C~~C~~~l~~~~~f~~~~d-G~~yC~~C~~~  113 (336)
                      .|..|+..++ ..+|..+.. +.-+|..||..
T Consensus         2 ~C~~Cg~D~t-~vryh~~~~~~~dLC~~CF~~   32 (45)
T cd02336           2 HCFTCGNDCT-RVRYHNLKAKKYDLCPSCYQE   32 (45)
T ss_pred             cccCCCCccC-ceEEEecCCCccccChHHHhC
Confidence            4777777775 445543322 34678888765


Done!