BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 019779
         (336 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3LYE|A Chain A, Crystal Structure Of Oxaloacetate Acetylhydrolase
 pdb|3M0J|A Chain A, Structure Of Oxaloacetate Acetylhydrolase In Complex With
           The Inhibitor 3,3-Difluorooxalacetate
 pdb|3M0K|A Chain A, Structure Of Oxaloacetate Acetylhydrolase In Complex With
           The Product Oxalate
          Length = 307

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%)

Query: 73  EKGSEPLITVEALHQL--HILIFFLAVFHVLYSAITMMLGRLKIRG 116
           E G  PLITVE    +   I+IF  A     Y+AI   L RL+  G
Sbjct: 224 ENGHSPLITVEEAKAMGFRIMIFSFATLAPAYAAIRETLVRLRDHG 269


>pdb|1J0A|A Chain A, Crystal Structure Analysis Of The Acc Deaminase Homologue
 pdb|1J0A|B Chain B, Crystal Structure Analysis Of The Acc Deaminase Homologue
 pdb|1J0A|C Chain C, Crystal Structure Analysis Of The Acc Deaminase Homologue
 pdb|1J0B|A Chain A, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|B Chain B, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|C Chain C, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|D Chain D, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|E Chain E, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|F Chain F, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|G Chain G, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|H Chain H, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|I Chain I, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|J Chain J, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|K Chain K, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|L Chain L, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|M Chain M, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|N Chain N, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|O Chain O, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|P Chain P, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|Q Chain Q, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|R Chain R, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|S Chain S, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|T Chain T, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|U Chain U, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|V Chain V, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|W Chain W, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
 pdb|1J0B|X Chain X, Crystal Structure Analysis Of The Acc Deaminase Homologue
           Complexed With Inhiitor
          Length = 325

 Score = 28.5 bits (62), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 26/43 (60%)

Query: 74  KGSEPLITVEALHQLHILIFFLAVFHVLYSAITMMLGRLKIRG 116
           KG++ +ITV A+H  H  +  LA   +   AI ++ G+ +++G
Sbjct: 68  KGADVVITVGAVHSNHAFVTGLAAKKLGLDAILVLRGKEELKG 110


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.140    0.449 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,780,982
Number of Sequences: 62578
Number of extensions: 372412
Number of successful extensions: 775
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 774
Number of HSP's gapped (non-prelim): 5
length of query: 336
length of database: 14,973,337
effective HSP length: 99
effective length of query: 237
effective length of database: 8,778,115
effective search space: 2080413255
effective search space used: 2080413255
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 52 (24.6 bits)