Citrus Sinensis ID: 019817

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-----

MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLADNKVSEDGFLVVMLSKSKTLGSAGASSAQPAHTTPPTTAPSSNSTPPQEASVPPPAPTPSIPASNVTSNVTAANANSDTYGQAASNLVAGNDLEQTIQQIMDMGGGTWDKETVTRALQAAYNNPERAVDYLYSGIPETAEVAVPVAHFPASQAAETGAAGAAPVSGVPNSSPLNMFPQETLSGAPAGGLGSLDFLRNNQQLINEPVDGSEGDMFDQPEQDMPHAINVTPAEQEAIQRLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED

cEEEEEcccccEEEEEEcccccHHHHHHHHHHHcccccccccccEEEEccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHHHHHHccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccHHHHHHcHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHccccccc

MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLADNKVSEDGFLVVML************************************************************************LVAGNDLEQTIQQIMDMGGGTWDKETVTRALQAAYNNPERAVDYLYSGIPE*************************************************************************************************IQRLEAMGFDRALVIEAFLACDRNEELAANYLLEN******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
UV excision repair protein RAD23 homolog A	Involved in nucleotide excision repair and is thought to be functional equivalent for Rad23b in global genome nucleotide excision repair (GG-NER) by association with Xpc. In vitro, the XPC:RAD23A dimer has NER activity. Can stabilize Xpc. Reported differences to Rad23b in regard to NER activity and Xpc stabilization are probably due to differences in expression levels with Rad23a being much less expressed than Rad23b.	probable	P54726
UV excision repair protein RAD23 homolog A	Involved in nucleotide excision repair and is thought to be functional equivalent for RAD23B in global genome nucleotide excision repair (GG-NER) by association with XPC. In vitro, XPC:RAD23A dimer has NER activity. Can stabilize XPC.	probable	A3KMV2
UV excision repair protein RAD23 homolog A	Involved in vpr-dependent replication of HIV-1 in non-proliferating cells and primary macrophages. Required for the association of HIV-1 vpr with the host proteasome.	probable	P54725

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OQY, chain A
Confidence level:very confident
Coverage over the Query: 1-334
View the alignment between query and template
View the model in PyMOL