Citrus Sinensis ID: 019870

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330----

MAASLQAAATLMQPTKVGVVPARSSSLQLRSSQSVSKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAESVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESLQPSDTDMGAKVPKDVKIQGIWYAQLEQ

cHHHHHHHHHHcccccccccccccccccccccHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHcccEEEEECcCECcccccccccccccccccccccccccccccccEEEEEECcccccccccccccCEEEEEEEEcccCEEEEEEcccccEEEEECcccEEEEEEEEcccccCEEEEEEEEEHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccEEEEEEEEEEccccccEEEEEEEEccccccccccccccEEEEEEEEEEEcc

********ATL*******************************SAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVK************QNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRG*******ENIKNTSSSTGKITLSVTKSKPETGEVIGVFESLQ*******AKVPKDVKIQGIWYAQLE*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Oxygen-evolving enhancer protein 1-2, chloroplastic	Stabilizes the manganese cluster which is the primary site of water splitting. Regulates dephosphorylation and turnover of the PSII reaction center D1 protein.	confident	Q9S841
Oxygen-evolving enhancer protein 1, chloroplastic	Stabilizes the manganese cluster which is the primary site of water splitting (By similarity). Binds GTP after preillumination of photosystem II core complex. This binding is inhibited by DCMU.	probable	P12359
Oxygen-evolving enhancer protein 1, chloroplastic	Stabilizes the manganese cluster which is the primary site of water splitting.	probable	P85194

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ARC, chain O
Confidence level:very confident
Coverage over the Query: 100-334
View the alignment between query and template
View the model in PyMOL