Citrus Sinensis ID: 019903

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330----
MIFSSALLANPPCVCLPRKFPVRCSSLPVSAASQLRSTQFDLKTYWTTLITEIDQNLEKAITVKYPEQIYESMRYSVLAKGTKRAPPVMCVAACELFGVNRIAAFPTACALEMVHAASLIHDDLPCMDDDPSRRGQPSNHTVYGVDIAILAGDALFPLGFQHIVSHTPPHLVPEPRVLRVIAEIARAVGSTGMAAGQFLDLEGEPNLVEFVQEKKFGEMSECSAVCGGFLAGADDDEIQSLRRYGRAVGVLYQVVDDILEAKAQTPRDEEKKKKKGKSYVAFYGVEKAMEVAEELRAKAKEELDRFKKYGDNVLPLYSFIDYAADREFSVVDSR
cccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHcccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHcHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcHHHHHHHHHHHcccccccccHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccc
*************************************TQFDLKTYWTTLITEIDQNLEKAITVKYPEQIYESMRYSVLAKGTKRAPPVMCVAACELFGVNRIAAFPTACALEMVHAASLIHDDLPCMDDDPSRRGQPSNHTVYGVDIAILAGDALFPLGFQHIVSHTPPHLVPEPRVLRVIAEIARAVGSTGMAAGQFLDLEGEPNLVEFVQEKKFGEMSECSAVCGGFLAGADDDEIQSLRRYGRAVGVLYQVVDDILEA*****************YVAFYGVEKAMEVAEELRAKAKEELDRFKKYGDNVLPLYSFIDYAADREFSV****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIFSSALLANPPCVCLPRKFPVRCSSLPVSAASQLRSTQFDLKTYWTTLITEIDQNLEKAITVKYPEQIYESMRYSVLAKGTKRAPPVMCVAACELFGVNRIAAFPTACALEMVHAASLIHDDLPCMDDDPSRRGQPSNHTVYGVDIAILAGDALFPLGFQHIVSHTPPHLVPEPRVLRVIAEIARAVGSTGMAAGQFLDLEGEPNLVEFVQEKKFGEMSECSAVCGGFLAGADDDEIQSLRRYGRAVGVLYQVVDDILEAKAQTPRDEEKKKKKGKSYVAFYGxxxxxxxxxxxxxxxxxxxxxxxxxxxxVLPLYSFIDYAADREFSVVDSR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic Heterodimeric geranyl(geranyl)-diphosphate (GPP) synthase small subunit. The small subunit alone is inactive in vitro while the large subunit GGPPS1 catalyzes mainly the production of geranygeranyl-diphosphate in vitro. Upon association of the two subunits, the product profile changes and the production of gerany-diphosphate is strongly increased.probableQ39108

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.5.-.-Transferring alkyl or aryl groups, other than methyl groups.probable
2.5.1.-5,10-methenyltetrahydromethanopterin hydrogenase.probable
2.5.1.10(2E,6E)-farnesyl diphosphate synthase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J1P, chain A
Confidence level:very confident
Coverage over the Query: 42-263,276-328
View the alignment between query and template
View the model in PyMOL