BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 019918
         (334 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1CWP|A Chain A, Structures Of The Native And Swollen Forms Of Cowpea
           Chlorotic Mottle Virus Determined By X-Ray
           Crystallography And Cryo-Electron Microscopy
 pdb|1CWP|B Chain B, Structures Of The Native And Swollen Forms Of Cowpea
           Chlorotic Mottle Virus Determined By X-Ray
           Crystallography And Cryo-Electron Microscopy
 pdb|1CWP|C Chain C, Structures Of The Native And Swollen Forms Of Cowpea
           Chlorotic Mottle Virus Determined By X-Ray
           Crystallography And Cryo-Electron Microscopy
          Length = 190

 Score = 27.7 bits (60), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 50/112 (44%), Gaps = 15/112 (13%)

Query: 54  STWTAKRSPLCSNITCSATDRSDPEISSAARIRNEVLSPFRSVRMFFYLAFVASGSLGGL 113
           S WTA  +   + +T + T     E+SS    RN+ L   R V ++  L    SG++   
Sbjct: 53  SKWTASCAAAEAKVTSAITISLPNELSSE---RNKQLKVGR-VLLWLGLLPSVSGTVKSC 108

Query: 114 IAITQLIGA------LANPARAADV-----PEILKGLSIDVSAVSLFAFLYS 154
           +  TQ   A      LA    + DV     PE  KG++++  A  L  +LYS
Sbjct: 109 VTETQTTAAASFQVALAVADNSKDVVAAMYPEAFKGITLEQLAADLTIYLYS 160


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.135    0.405 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,350,331
Number of Sequences: 62578
Number of extensions: 349507
Number of successful extensions: 720
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 717
Number of HSP's gapped (non-prelim): 7
length of query: 334
length of database: 14,973,337
effective HSP length: 99
effective length of query: 235
effective length of database: 8,778,115
effective search space: 2062857025
effective search space used: 2062857025
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)