Citrus Sinensis ID: 019925


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330----
MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWRPGEKDDRVVIKDPNPNLFFASQVINNACATQAILSILLNCPDIDIGPELSKLKEFTKNFPPELKGLAINNSDAIRAAHNSFARPEPFVPEEQKAAGKDDDVYHFISYIPVDGVLYELDGLKEGPISLGPCTGGQGDMDWLQMVQPVIQERIERYSKSEIRFNLMAVIKNRKELYTAELKEFQRKRERILQQLASLQSERMVDKTSFEALNKSLSEVNAGIEGATEKILMEEEKFKKWRTENIRRKHNYIPFLFNFLKILAEKKQLKPLIEKAKQKTSSSS
ccccccccccHHHHHHHHHcccccccEEEcccccHHHHHccccccEEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHcccccHHHHHHHHHcccccccccccccccccccccEEEEEEEEcccEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHccccccEEEHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccc
*SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWRPGEKDDRVVIKDPNPNLFFASQVINNACATQAILSILLNCPDIDIGPELSKLKEFTKNFPPELKGLAINNSDAIRAAHNS******************DDVYHFISYIPVDGVLYELDGLKEGPISLGPCTGGQGDMDWLQMVQPVIQERIERYSKSEIRFNLMAVIKNRKELYTAELKEFQR***********************************GIEGATEKILMEEEKFKKWRTENIRRKHNYIPFLFNFLKILAEKKQLKPL************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWRPGEKDDRVVIKDPNPNLFFASQVINNACATQAILSILLNCPDIDIGPELSKLKEFTKNFPPELKGLAINNSDAIRAAHNSFARPEPFVPEEQKAAGKDDDVYHFISYIPVDGVLYELDGLKEGPISLGPCTGGQGDMDWLQMVQPVIQERIERYSKSEIRFNLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRMVDKTSFEALNKSLSEVNAGIEGATEKILMEEEKFKKWRTENIRRKHNYIPFLFNFLKILAEKKQLKPLIEKAKQKTSSSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin carboxyl-terminal hydrolase isozyme L5 Protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains. Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome.probableQ54N38
Ubiquitin carboxyl-terminal hydrolase isozyme L5 Protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains. Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome. Putative regulatory component of the INO80 complex; however is inactive in the INO80 complex and is activated by a transient interaction of the INO80 complex with the proteasome via ADRM1.probableQ9XSJ0
Ubiquitin carboxyl-terminal hydrolase isozyme L5 Protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains. Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome. Putative regulatory component of the INO80 complex; however is inactive in the INO80 complex and is activated by a transient interaction of the INO80 complex with the proteasome via ADRM1.probableQ06AT3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.19.-Omega peptidases.probable
3.4.19.12Ubiquitinyl hydrolase 1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IHR, chain A
Confidence level:very confident
Coverage over the Query: 2-136,155-322
View the alignment between query and template
View the model in PyMOL