Citrus Sinensis ID: 020025

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--
MHLDSSSLKMKTMVSIPEAPLGSTGKTIPLVGFGTAQFPFGAATEAVKESVVHAIEVGYRHFDTAAIYQSEEPLGEAIAQALRLGLIKSRDELFITSKLWFGHAHRQLVLPALQTSLKNLGLEHIDLYLIHFPVSLKPGTGFPFSKEDIEPLDYEGVWEAMEECQNLGLTKSIGVSNFACKKLERLLATAKIPPAVNQVELNPVWQQKKLRDFCEKKGIHITAYSPLGAKGTIWGTNRVMECQMLKEIANAKGKSVAQVSLRWVYQQGVSLVVKSFNKERMKENLDIFYWELSAEELQKIEQIPQYRGSRSEEHVSEDGPYKSLEDLWDGEI
cccccccHHHHHccccccEEcccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccccccccEEEEccccccccccccHHHHHHHHHHHHccccccccEEcccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHcccEEEEEccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHcccEEEEccccHHHHHHHHccccccccHHHHHHHHccccccccccccccccccccccccccccccc
***************IPEAPLGSTGKTIPLVGFGTAQFPFGAATEAVKESVVHAIEVGYRHFDTAAIYQSEEPLGEAIAQALRLGLIKSRDELFITSKLWFGHAHRQLVLPALQTSLKNLGLEHIDLYLIHFPVSLKPGTGFPFSKEDIEPLDYEGVWEAMEECQNLGLTKSIGVSNFACKKLERLLATAKIPPAVNQVELNPVWQQKKLRDFCEKKGIHITAYSPLGAKGTIWGTNRVMECQMLKEIANAKGKSVAQVSLRWVYQQGVSLVVKSFNKERMKENLDIFYWELSAEELQKIEQIPQYRGSRSEEHVSEDGPYKSLEDLWDGEI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHLDSSSLKMKTMVSIPEAPLGSTGKTIPLVGFGTAQFPFGAATEAVKESVVHAIEVGYRHFDTAAIYQSEEPLGEAIAQALRLGLIKSRDELFITSKLWFGHAHRQLVLPALQTSLKNLGLEHIDLYLIHFPVSLKPGTGFPFSKEDIEPLDYEGVWEAMEECQNLGLTKSIGVSNFACKKLERLLATAKIPPAVNQVELNPVWQQKKLRDFCEKKGIHITAYSPLGAKGTIWGTNRVMECQMLKEIANAKGKSVAQVSLRWVYQQGVSLVVKSFNKERMKENLDIFYWELSAEELQKIEQIPQYRGSRSEEHVSEDGPYKSLEDLWDGEI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADPH-dependent codeinone reductase 1-3 Reduces codeinone to codeine in the penultimate step in morphine biosynthesis. Can use morphinone, hydrocodone and hydromorphone as substrate during reductive reaction with NADPH as cofactor, and morphine and dihydrocodeine as substrate during oxidative reaction with NADP as cofactor.probableQ9SQ68
NADPH-dependent codeinone reductase 1-2 Reduces codeinone to codeine in the penultimate step in morphine biosynthesis. Can use morphinone, hydrocodone and hydromorphone as substrate during reductive reaction with NADPH as cofactor, and morphine and dihydrocodeine as substrate during oxidative reaction with NADP as cofactor.probableQ9SQ69
Prostaglandin F synthase 1 Catalyzes the reduction of PGD(2) and PGH(2) to PGF(2 alpha) and a stereoisomer, respectively. It has a broad substrate specificity and reduces also other carbonyl compounds.probableP05980

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H7U, chain A
Confidence level:very confident
Coverage over the Query: 15-332
View the alignment between query and template
View the model in PyMOL