Query         020057
Match_columns 331
No_of_seqs    180 out of 285
Neff          3.8 
Searched_HMMs 46136
Date          Fri Mar 29 06:40:30 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/020057.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/020057hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd06160 S2P-M50_like_2 Unchara  99.1 1.4E-10   3E-15  104.4   5.6   75  253-330     2-76  (183)
  2 cd06164 S2P-M50_SpoIVFB_CBS Sp  97.7 9.5E-05 2.1E-09   68.6   6.9   46  279-324    37-82  (227)
  3 cd06161 S2P-M50_SpoIVFB SpoIVF  97.3 0.00031 6.8E-09   64.0   4.4   43  282-324    25-67  (208)
  4 cd06159 S2P-M50_PDZ_Arch Uncha  97.1  0.0014 2.9E-08   62.7   6.9   34  285-318   108-141 (263)
  5 cd06162 S2P-M50_PDZ_SREBP Ster  95.3   0.018   4E-07   55.8   3.9   28  291-318   131-158 (277)
  6 KOG2921 Intramembrane metallop  90.6    0.21 4.6E-06   51.3   3.1   41  285-325   120-162 (484)
  7 PF05572 Peptidase_M43:  Pregna  76.0     1.2 2.6E-05   39.4   0.9   12  297-308    71-82  (154)
  8 PF06114 DUF955:  Domain of unk  64.7     4.1 8.9E-05   31.6   1.6   14  299-312    46-59  (122)
  9 PF07423 DUF1510:  Protein of u  58.6     5.7 0.00012   37.6   1.6   63  159-230   150-213 (217)
 10 PF13485 Peptidase_MA_2:  Pepti  56.7     8.9 0.00019   30.0   2.2   17  297-313    27-43  (128)
 11 PF13688 Reprolysin_5:  Metallo  55.2     6.7 0.00014   34.5   1.4   16  296-311   143-158 (196)
 12 PRK03982 heat shock protein Ht  52.8     8.7 0.00019   36.7   1.9   12  295-307   126-137 (288)
 13 PRK03001 M48 family peptidase;  52.8     8.7 0.00019   36.6   1.9   11  296-307   126-136 (283)
 14 PF01435 Peptidase_M48:  Peptid  52.0      10 0.00022   33.3   2.1   17  298-316    92-108 (226)
 15 COG0501 HtpX Zn-dependent prot  51.7     9.4  0.0002   35.4   1.9   13  294-307   157-169 (302)
 16 PF13582 Reprolysin_3:  Metallo  50.4     7.5 0.00016   31.5   0.9   13  297-309   109-121 (124)
 17 cd04267 ZnMc_ADAM_like Zinc-de  49.9     7.4 0.00016   34.2   0.8   18  296-313   134-151 (192)
 18 COG5309 Exo-beta-1,3-glucanase  49.8      31 0.00068   34.4   5.2   61  158-222   218-281 (305)
 19 COG1994 SpoIVFB Zn-dependent p  49.8      14  0.0003   34.4   2.6   41  283-323    40-80  (230)
 20 PF00413 Peptidase_M10:  Matrix  48.9      11 0.00023   31.6   1.6   13  298-310   108-120 (154)
 21 cd04279 ZnMc_MMP_like_1 Zinc-d  48.8      11 0.00024   32.3   1.7   20  297-316   106-125 (156)
 22 PF13574 Reprolysin_2:  Metallo  48.6     7.6 0.00016   34.5   0.7   17  296-312   112-128 (173)
 23 PRK04897 heat shock protein Ht  47.9      11 0.00025   36.3   1.9   11  296-307   139-149 (298)
 24 PRK02870 heat shock protein Ht  47.8      10 0.00022   37.8   1.5   10  296-306   175-184 (336)
 25 cd04269 ZnMc_adamalysin_II_lik  47.1      13 0.00028   32.8   2.0   17  295-311   131-147 (194)
 26 PRK11037 hypothetical protein;  46.9      65  0.0014   26.7   5.7   65  152-217     4-81  (83)
 27 PRK01345 heat shock protein Ht  45.6      13 0.00028   36.5   1.9   13  294-307   124-136 (317)
 28 PRK12462 phosphoserine aminotr  45.5      42 0.00092   33.8   5.5   66  150-223     9-76  (364)
 29 PF02031 Peptidase_M7:  Strepto  45.1      13 0.00028   33.1   1.6   11  298-308    80-90  (132)
 30 PRK03072 heat shock protein Ht  44.5      14  0.0003   35.7   1.9   11  296-307   129-139 (288)
 31 cd04275 ZnMc_pappalysin_like Z  43.0       4 8.7E-05   38.4  -2.0   12  297-308   139-150 (225)
 32 PRK05457 heat shock protein Ht  42.8      15 0.00034   35.4   1.9   10  296-306   136-145 (284)
 33 KOG2719 Metalloprotease [Gener  42.4      14 0.00031   38.4   1.6   12  296-308   282-293 (428)
 34 COG2856 Predicted Zn peptidase  42.3      13 0.00029   34.9   1.4   14  299-312    76-89  (213)
 35 PRK02391 heat shock protein Ht  42.1      16 0.00035   35.5   1.9   10  296-306   135-144 (296)
 36 PLN02452 phosphoserine transam  41.6      58  0.0012   32.5   5.7   67  149-223    11-79  (365)
 37 PF10692 DUF2498:  Protein of u  41.5      83  0.0018   26.0   5.6   64  153-217     4-80  (82)
 38 PRK01265 heat shock protein Ht  41.0      17 0.00037   36.2   1.9   10  296-306   142-151 (324)
 39 cd00203 ZnMc Zinc-dependent me  40.6      14 0.00031   31.1   1.2   17  295-311    96-112 (167)
 40 COG3824 Predicted Zn-dependent  39.6      13 0.00029   33.0   0.8   18  196-213    21-38  (136)
 41 PF04315 DUF462:  Protein of un  39.3      16 0.00035   33.5   1.4   11  299-309    45-55  (164)
 42 PF01434 Peptidase_M41:  Peptid  36.1      25 0.00054   32.2   2.1   18  296-313    29-46  (213)
 43 PF13699 DUF4157:  Domain of un  35.7      22 0.00049   28.2   1.5   12  298-309    64-75  (79)
 44 PF01421 Reprolysin:  Reprolysi  35.6      26 0.00057   31.1   2.1   21  293-313   129-149 (199)
 45 PF12046 DUF3529:  Protein of u  34.9 1.9E+02  0.0042   26.8   7.5   20  194-216    40-59  (173)
 46 smart00235 ZnMc Zinc-dependent  34.6      21 0.00045   29.8   1.2   13  298-310    89-101 (140)
 47 cd04270 ZnMc_TACE_like Zinc-de  33.5      26 0.00057   32.9   1.8   17  295-311   167-183 (244)
 48 cd04268 ZnMc_MMP_like Zinc-dep  33.3      39 0.00084   28.6   2.7   15  296-310    95-109 (165)
 49 PF13583 Reprolysin_4:  Metallo  32.1      23 0.00049   32.5   1.1   15  299-313   141-155 (206)
 50 KOG1832 HIV-1 Vpr-binding prot  32.0      48   0.001   38.2   3.7   15    5-19   1354-1368(1516)
 51 cd04277 ZnMc_serralysin_like Z  31.2      25 0.00055   30.9   1.2   14  297-310   115-128 (186)
 52 PF04228 Zn_peptidase:  Putativ  31.1      41  0.0009   33.1   2.8   12  299-310   174-185 (292)
 53 cd04278 ZnMc_MMP Zinc-dependen  31.0      22 0.00049   30.5   0.9   13  298-310   110-122 (157)
 54 PF15281 Consortin_C:  Consorti  30.2 1.1E+02  0.0023   26.8   4.8   12  297-308   101-112 (113)
 55 PF10263 SprT-like:  SprT-like   29.3      31 0.00067   29.3   1.4   11  299-309    64-74  (157)
 56 cd04272 ZnMc_salivary_gland_MP  28.7      34 0.00075   31.1   1.7   18  296-313   146-163 (220)
 57 PF01990 ATP-synt_F:  ATP synth  27.6 2.8E+02  0.0061   22.1   6.6   51  168-237    15-79  (95)
 58 PF08002 DUF1697:  Protein of u  26.9 1.3E+02  0.0028   26.1   4.9   57  154-218    17-75  (137)
 59 PF08800 VirE_N:  VirE N-termin  26.7   2E+02  0.0044   24.8   6.0   59  154-212    39-112 (136)
 60 TIGR02500 type_III_yscD type I  26.2 1.6E+02  0.0034   29.9   6.0   39  181-219   302-340 (410)
 61 PF14891 Peptidase_M91:  Effect  25.7      46 0.00099   29.6   1.9   16  296-311   104-119 (174)
 62 PTZ00429 beta-adaptin; Provisi  25.4      88  0.0019   34.7   4.3   32   75-106   608-639 (746)
 63 PHA02456 zinc metallopeptidase  24.2      46   0.001   29.5   1.6   23  299-321    83-107 (141)
 64 cd04927 ACT_ACR-like_2 Second   23.9      99  0.0021   23.8   3.2   34  169-213    40-73  (76)
 65 PF05683 Fumerase_C:  Fumarase   23.7 1.1E+02  0.0023   29.2   3.9   43  152-210    31-73  (205)
 66 PF01431 Peptidase_M13:  Peptid  23.5      58  0.0012   29.0   2.1   19  290-308    31-49  (206)
 67 KOG0391 SNF2 family DNA-depend  23.2 1.3E+02  0.0027   36.1   5.0   18  297-314   813-830 (1958)
 68 PF13492 GAF_3:  GAF domain; PD  23.1 1.7E+02  0.0037   22.4   4.4   28  195-222     1-29  (129)
 69 PF11667 DUF3267:  Protein of u  23.0      27 0.00058   28.7  -0.1   21  295-315     4-24  (111)
 70 PF05265 DUF723:  Protein of un  23.0 1.6E+02  0.0034   23.1   4.1   36  199-237     4-39  (60)
 71 PF12388 Peptidase_M57:  Dual-a  22.5      50  0.0011   31.4   1.6   22  289-310   127-148 (211)
 72 PF04155 Ground-like:  Ground-l  22.4      58  0.0013   25.3   1.7   26  194-219    22-47  (76)
 73 PF01454 MAGE:  MAGE family;  I  22.3 3.7E+02   0.008   23.9   7.0   26  193-220    29-54  (195)
 74 PRK13267 archaemetzincin-like   22.1      45 0.00097   30.5   1.2   11  298-308   128-138 (179)
 75 PF09471 Peptidase_M64:  IgA Pe  22.1      45 0.00098   32.2   1.2   12  297-308   218-229 (264)
 76 KOG2236 Uncharacterized conser  22.0 1.2E+02  0.0025   32.3   4.2   22  140-161   179-200 (483)
 77 PF08219 TOM13:  Outer membrane  21.6      73  0.0016   26.1   2.1   20  297-318    54-73  (77)
 78 PRK06842 fumarate hydratase; P  21.4      95   0.002   29.0   3.1   61  154-237     7-67  (185)
 79 PLN03199 delta6-acyl-lipid des  21.3   2E+02  0.0044   29.9   5.9   17  195-212   109-125 (485)
 80 PF07998 Peptidase_M54:  Peptid  21.1      44 0.00095   31.2   0.9   31  185-216     5-37  (194)
 81 smart00731 SprT SprT homologue  21.0      57  0.0012   28.1   1.5   11  300-310    64-74  (146)
 82 PF12315 DUF3633:  Protein of u  20.7      58  0.0013   31.1   1.6   27  284-313    84-110 (212)
 83 KOG2987 Fatty acid desaturase   20.5 2.7E+02  0.0058   28.0   6.1   13  296-308    84-96  (324)
 84 TIGR01364 serC_1 phosphoserine  20.5 1.4E+02  0.0031   29.2   4.4   60  155-222     2-63  (349)
 85 KOG3320 40S ribosomal protein   20.2 1.5E+02  0.0033   27.9   4.2   27  196-222    73-99  (192)
 86 COG4783 Putative Zn-dependent   20.2      62  0.0013   34.3   1.8    7  300-306   135-141 (484)

No 1  
>cd06160 S2P-M50_like_2 Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with additional putative N- and C-terminal transmembrane spanning regions, relative to the core protein, and no PDZ domains.
Probab=99.08  E-value=1.4e-10  Score=104.42  Aligned_cols=75  Identities=35%  Similarity=0.461  Sum_probs=61.9

Q ss_pred             HHHHHHHHHHHhhccccccccchhhccchhHhhhchhhHHHHHHHHHHHHHHHHHHHHHcCCccccceeccccccccc
Q 020057          253 AFGLVTVFTLLLRNVPALQSNLLSTFDNLNLLTNGLPGALVTALVIGVHELGHILAAKSTGVELGVPYFVPSWQALLV  330 (331)
Q Consensus       253 LLfl~Tl~TTl~aGa~~L~~~~L~~f~~p~~l~~gLP~al~ll~ILgvHE~GHylaArr~gVklSlPyFIP~~QLGsv  330 (331)
                      +++++|++|....+......   .+.++++.+..+++++++++.++.+||+||+++||++|+|+..|+|+|++++|++
T Consensus         2 ~~~~~s~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~l~l~~~l~iHElgH~~~A~~~G~~~~~~~l~P~~~~G~~   76 (183)
T cd06160           2 LLLVLTLLTTLLVGAWLSGN---DVPGNPLLLLQGLPFALALLAILGIHEMGHYLAARRHGVKASLPYFIPFPFIGTF   76 (183)
T ss_pred             HHHHHHHHHHHHHHHHHhcc---cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCccceeeeehHhcCcE
Confidence            45688998888877531111   2336788899999999999999999999999999999999999999998777754


No 2  
>cd06164 S2P-M50_SpoIVFB_CBS SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation. In this subgroup, SpoIVFB (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain. SpoIVFB is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB. It has been proposed tha
Probab=97.69  E-value=9.5e-05  Score=68.62  Aligned_cols=46  Identities=26%  Similarity=0.249  Sum_probs=39.7

Q ss_pred             cchhHhhhchhhHHHHHHHHHHHHHHHHHHHHHcCCccccceeccc
Q 020057          279 DNLNLLTNGLPGALVTALVIGVHELGHILAAKSTGVELGVPYFVPS  324 (331)
Q Consensus       279 ~~p~~l~~gLP~al~ll~ILgvHE~GHylaArr~gVklSlPyFIP~  324 (331)
                      .++..+.-|+.++++++.++.+||+||+++||++|+|+.--.+.|+
T Consensus        37 ~~~~~~~~g~~~~~~l~~~v~iHElgH~~~A~~~G~~v~~i~l~p~   82 (227)
T cd06164          37 LGAVAWLLGLAAALLLFASVLLHELGHSLVARRYGIPVRSITLFLF   82 (227)
T ss_pred             cchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCeECeEEEEee
Confidence            3455677899999999999999999999999999999987677764


No 3  
>cd06161 S2P-M50_SpoIVFB SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation. SpoIVFB (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB.
Probab=97.25  E-value=0.00031  Score=63.96  Aligned_cols=43  Identities=33%  Similarity=0.417  Sum_probs=37.0

Q ss_pred             hHhhhchhhHHHHHHHHHHHHHHHHHHHHHcCCccccceeccc
Q 020057          282 NLLTNGLPGALVTALVIGVHELGHILAAKSTGVELGVPYFVPS  324 (331)
Q Consensus       282 ~~l~~gLP~al~ll~ILgvHE~GHylaArr~gVklSlPyFIP~  324 (331)
                      ..+..++.+++.++.++.+||+||+++||++|+++.--.+.|+
T Consensus        25 ~~~~~~~~~~l~l~~~v~iHElgH~~~A~~~G~~v~~i~l~p~   67 (208)
T cd06161          25 VAWLLGLLEALLLFLSVLLHELGHALVARRYGIRVRSITLLPF   67 (208)
T ss_pred             chHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCccceEEEee
Confidence            3566788999999999999999999999999999876666664


No 4  
>cd06159 S2P-M50_PDZ_Arch Uncharacterized Archaeal homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group appears to be limited to Archaeal S2P/M50s homologs with additional putative N-terminal transmembrane spanning regions, relative to the core protein, and either one or two PDZ domains present.
Probab=97.08  E-value=0.0014  Score=62.69  Aligned_cols=34  Identities=24%  Similarity=0.292  Sum_probs=28.0

Q ss_pred             hhchhhHHHHHHHHHHHHHHHHHHHHHcCCcccc
Q 020057          285 TNGLPGALVTALVIGVHELGHILAAKSTGVELGV  318 (331)
Q Consensus       285 ~~gLP~al~ll~ILgvHE~GHylaArr~gVklSl  318 (331)
                      ...+.+.++++..+.+||+||.++||++|+++..
T Consensus       108 i~~~~~~iaL~isv~iHElgHa~~Ar~~G~~V~~  141 (263)
T cd06159         108 IPLPYGIIALVVGVVVHELSHGILARVEGIKVKS  141 (263)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHcCCEECc
Confidence            3455566677778889999999999999999875


No 5  
>cd06162 S2P-M50_PDZ_SREBP Sterol regulatory element-binding protein (SREBP) Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50A), regulates intramembrane proteolysis (RIP) of SREBP and is part of a signal transduction mechanism involved in sterol and lipid metabolism. In sterol-depleted mammalian cells, a two-step proteolytic process releases the N-terminal domains of SREBPs from membranes of the endoplasmic reticulum (ER). These domains translocate into the nucleus, where they activate genes of cholesterol and fatty acid biosynthesis. The first cleavage occurs at Site-1 within the ER lumen to generate an intermediate that is subsequently released from the membrane by cleavage at Site-2, which lies within the first transmembrane domain. It is the second proteolytic step that is carried out by the SREBP Site-2 protease (S2P) which is present in this CD family.  This group appears to be limited to eumetazoan proteins and contains one PDZ domain.
Probab=95.27  E-value=0.018  Score=55.76  Aligned_cols=28  Identities=29%  Similarity=0.218  Sum_probs=23.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHcCCcccc
Q 020057          291 ALVTALVIGVHELGHILAAKSTGVELGV  318 (331)
Q Consensus       291 al~ll~ILgvHE~GHylaArr~gVklSl  318 (331)
                      .++++....+||+||.++|+++|+++.-
T Consensus       131 l~al~isvvvHElgHal~A~~~gi~V~~  158 (277)
T cd06162         131 FTALLISGVVHEMGHGVAAVREQVRVNG  158 (277)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHcCCeece
Confidence            3455566778999999999999999875


No 6  
>KOG2921 consensus Intramembrane metalloprotease (sterol-regulatory element-binding protein (SREBP) protease) [Posttranslational modification, protein turnover, chaperones]
Probab=90.57  E-value=0.21  Score=51.29  Aligned_cols=41  Identities=37%  Similarity=0.592  Sum_probs=29.1

Q ss_pred             hhchhhHHHHHHH-HHHHHHHHHHHHHHcCCccc-cceecccc
Q 020057          285 TNGLPGALVTALV-IGVHELGHILAAKSTGVELG-VPYFVPSW  325 (331)
Q Consensus       285 ~~gLP~al~ll~I-LgvHE~GHylaArr~gVklS-lPyFIP~~  325 (331)
                      +++++|-+..+.| +-+|||||-|||.+.||++. .=.||=++
T Consensus       120 l~~I~yf~t~lvi~~vvHElGHalAA~segV~vngfgIfi~ai  162 (484)
T KOG2921|consen  120 LSGIAYFLTSLVITVVVHELGHALAAASEGVQVNGFGIFIAAI  162 (484)
T ss_pred             cccchhhhhhHHHHHHHHHhhHHHHHHhcCceeeeeEEEEEEE
Confidence            5677776655544 44799999999999999975 33344333


No 7  
>PF05572 Peptidase_M43:  Pregnancy-associated plasma protein-A;  InterPro: IPR008754 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase M43 (cytophagalysin family, clan MA(M)), subfamily M43. The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH. The type example of this family is the pregnancy-associated plasma protein A (PAPP-A), which cleaves insulin-like growth factor (IGF) binding protein-4 (IGFBP-4), causing a dramatic reduction in its affinity for IGF-I and -II. Through this mechanism, PAPP-A is a regulator of IGF bioactivity in several systems, including the Homo sapiens ovary and the cardiovascular system [, , , ].; PDB: 3LUN_A 3LUM_B 2J83_A 2CKI_A.
Probab=76.04  E-value=1.2  Score=39.38  Aligned_cols=12  Identities=42%  Similarity=0.556  Sum_probs=9.7

Q ss_pred             HHHHHHHHHHHH
Q 020057          297 VIGVHELGHILA  308 (331)
Q Consensus       297 ILgvHE~GHyla  308 (331)
                      -.++||+|||+=
T Consensus        71 ~TltHEvGH~LG   82 (154)
T PF05572_consen   71 KTLTHEVGHWLG   82 (154)
T ss_dssp             HHHHHHHHHHTT
T ss_pred             cchhhhhhhhhc
Confidence            556999999973


No 8  
>PF06114 DUF955:  Domain of unknown function (DUF955);  InterPro: IPR010359 This is a family of bacterial and viral proteins with undetermined function. A conserved H-E-X-X-H motif is suggestive of a catalytic active site and shows similarity to IPR001915 from INTERPRO.; PDB: 3DTE_A 3DTK_A 3DTI_A.
Probab=64.72  E-value=4.1  Score=31.65  Aligned_cols=14  Identities=50%  Similarity=0.688  Sum_probs=10.7

Q ss_pred             HHHHHHHHHHHHHc
Q 020057          299 GVHELGHILAAKST  312 (331)
Q Consensus       299 gvHE~GHylaArr~  312 (331)
                      .+||+||++.-...
T Consensus        46 laHELgH~~~~~~~   59 (122)
T PF06114_consen   46 LAHELGHILLHHGD   59 (122)
T ss_dssp             HHHHHHHHHHHH-H
T ss_pred             HHHHHHHHHhhhcc
Confidence            48999999986654


No 9  
>PF07423 DUF1510:  Protein of unknown function (DUF1510);  InterPro: IPR009988 This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown.
Probab=58.56  E-value=5.7  Score=37.62  Aligned_cols=63  Identities=21%  Similarity=0.302  Sum_probs=43.4

Q ss_pred             hHHHHHhhcccccceEEEEeeeeeCCeEEEEcccCChHHHHHHHHHHHHHHhcCCceEEEEEecCCCC-CceE
Q 020057          159 ETIDILKDQVFGFDTFFVTNQEPYEGGVLFKGNLRGQAAKTYEKISTRMKNKFGDQYKLFLLVNPEDD-KPVA  230 (331)
Q Consensus       159 EdLk~IK~~~FG~dTFfvT~~e~~~qGVIfRGNLRg~pEevy~kL~~kLee~fGDrY~LfLvee~edg-KPV~  230 (331)
                      -|++-|+..     ..|+|++..-+=-+.|.||= |.|.+++..|+.+=  . |.+|+++|-=-.+.| ||+-
T Consensus       150 ~DW~Em~~A-----is~atgi~~~~mi~w~ign~-G~~~~a~gtVs~k~--~-~~~YrV~i~WVd~eGWkP~k  213 (217)
T PF07423_consen  150 VDWNEMLKA-----ISYATGISEDNMIVWFIGNN-GSPQKAIGTVSDKD--T-GKKYRVYIEWVDNEGWKPVK  213 (217)
T ss_pred             cCHHHHHHH-----HHHhhCCChhheEEEhhhcC-CcccceeEEeccCC--C-CceEEEEEEEecCCCcccee
Confidence            455544443     67899998888889999994 77799999988753  3 678997752111223 7764


No 10 
>PF13485 Peptidase_MA_2:  Peptidase MA superfamily
Probab=56.73  E-value=8.9  Score=30.00  Aligned_cols=17  Identities=29%  Similarity=0.311  Sum_probs=14.0

Q ss_pred             HHHHHHHHHHHHHHHcC
Q 020057          297 VIGVHELGHILAAKSTG  313 (331)
Q Consensus       297 ILgvHE~GHylaArr~g  313 (331)
                      -+.+||++|.|.....+
T Consensus        27 ~~l~HE~~H~~~~~~~~   43 (128)
T PF13485_consen   27 RVLAHELAHQWFGNYFG   43 (128)
T ss_pred             HHHHHHHHHHHHHHHcC
Confidence            45699999999988754


No 11 
>PF13688 Reprolysin_5:  Metallo-peptidase family M12; PDB: 2FV5_B 3EWJ_A 3KME_A 3L0T_B 1BKC_E 3G42_D 2I47_D 2FV9_B 3LEA_A 1ZXC_B ....
Probab=55.17  E-value=6.7  Score=34.47  Aligned_cols=16  Identities=38%  Similarity=0.511  Sum_probs=11.2

Q ss_pred             HHHHHHHHHHHHHHHH
Q 020057          296 LVIGVHELGHILAAKS  311 (331)
Q Consensus       296 ~ILgvHE~GHylaArr  311 (331)
                      .+..+||+||-|=|..
T Consensus       143 ~~~~AHEiGH~lGa~H  158 (196)
T PF13688_consen  143 AITFAHEIGHNLGAPH  158 (196)
T ss_dssp             HHHHHHHHHHHTT---
T ss_pred             ehhhHHhHHHhcCCCC
Confidence            4677999999998874


No 12 
>PRK03982 heat shock protein HtpX; Provisional
Probab=52.80  E-value=8.7  Score=36.73  Aligned_cols=12  Identities=58%  Similarity=0.653  Sum_probs=8.9

Q ss_pred             HHHHHHHHHHHHH
Q 020057          295 ALVIGVHELGHIL  307 (331)
Q Consensus       295 l~ILgvHE~GHyl  307 (331)
                      .+|+ +||+||+-
T Consensus       126 ~AVl-AHElgHi~  137 (288)
T PRK03982        126 EGVI-AHELTHIK  137 (288)
T ss_pred             HHHH-HHHHHHHH
Confidence            3444 89999984


No 13 
>PRK03001 M48 family peptidase; Provisional
Probab=52.77  E-value=8.7  Score=36.64  Aligned_cols=11  Identities=45%  Similarity=0.688  Sum_probs=8.4

Q ss_pred             HHHHHHHHHHHH
Q 020057          296 LVIGVHELGHIL  307 (331)
Q Consensus       296 ~ILgvHE~GHyl  307 (331)
                      +|| +||+||+-
T Consensus       126 aVl-AHElgHi~  136 (283)
T PRK03001        126 GVM-AHELAHVK  136 (283)
T ss_pred             HHH-HHHHHHHh
Confidence            444 89999984


No 14 
>PF01435 Peptidase_M48:  Peptidase family M48 This is family M48 in the peptidase classification. ;  InterPro: IPR001915 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M48 (Ste24 endopeptidase family, clan M-); members of both subfamily are represented. The members of this set of proteins are mostly described as probable protease htpX homologue (3.4.24 from EC) or CAAX prenyl protease 1, which proteolytically removes the C-terminal three residues of farnesylated proteins. They are integral membrane proteins associated with the endoplasmic reticulum and Golgi, binding one zinc ion per subunit. In Saccharomyces cerevisiae (Baker's yeast) Ste24p is required for the first NH2-terminal proteolytic processing event within the a-factor precursor, which takes place after COOH-terminal CAAX modification is complete. The Ste24p contains multiple predicted membrane spans, a zinc metalloprotease motif (HEXXH), and a COOH-terminal ER retrieval signal (KKXX). The HEXXH protease motif is critical for Ste24p activity, since Ste24p fails to function when conserved residues within this motif are mutated.  The Ste24p homologues occur in a diverse group of organisms, including Escherichia coli, Schizosaccharomyces pombe (Fission yeast), Haemophilus influenzae, and Homo sapiens (Human), which indicates that the gene is highly conserved throughout evolution. Ste24p and the proteins related to it define a subfamily of proteins that are likely to function as intracellular, membrane-associated zinc metalloproteases [].  HtpX is a zinc-dependent endoprotease member of the membrane-localized proteolytic system in E. coli, which participates in the proteolytic quality control of membrane proteins in conjunction with FtsH, a membrane-bound and ATP-dependent protease. Biochemical characterisation revealed that HtpX undergoes self-degradation upon cell disruption or membrane solubilization. It can also degraded casein and cleaves solubilized membrane proteins, for example, SecY []. Expression of HtpX in the plasma membrane is under the control of CpxR, with the metalloproteinase active site of HtpX located on the cytosolic side of the membrane. This suggests a potential role for HtpX in the response to mis-folded proteins [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis, 0016020 membrane; PDB: 3CQB_A 3C37_B.
Probab=52.02  E-value=10  Score=33.35  Aligned_cols=17  Identities=35%  Similarity=0.460  Sum_probs=11.6

Q ss_pred             HHHHHHHHHHHHHHcCCcc
Q 020057          298 IGVHELGHILAAKSTGVEL  316 (331)
Q Consensus       298 LgvHE~GHylaArr~gVkl  316 (331)
                      +.+||+||+.  .+|..+.
T Consensus        92 VlaHElgH~~--~~h~~~~  108 (226)
T PF01435_consen   92 VLAHELGHIK--HRHILKS  108 (226)
T ss_dssp             HHHHHHHHHH--TTHCCCC
T ss_pred             HHHHHHHHHH--cCCcchH
Confidence            3489999986  4554444


No 15 
>COG0501 HtpX Zn-dependent protease with chaperone function [Posttranslational modification, protein turnover, chaperones]
Probab=51.74  E-value=9.4  Score=35.40  Aligned_cols=13  Identities=54%  Similarity=0.818  Sum_probs=9.3

Q ss_pred             HHHHHHHHHHHHHH
Q 020057          294 TALVIGVHELGHIL  307 (331)
Q Consensus       294 ll~ILgvHE~GHyl  307 (331)
                      +.+|| +||+||+.
T Consensus       157 l~aVl-aHElgHi~  169 (302)
T COG0501         157 LEAVL-AHELGHIK  169 (302)
T ss_pred             HHHHH-HHHHHHHh
Confidence            34455 89999973


No 16 
>PF13582 Reprolysin_3:  Metallo-peptidase family M12B Reprolysin-like; PDB: 3P24_C.
Probab=50.40  E-value=7.5  Score=31.55  Aligned_cols=13  Identities=38%  Similarity=0.434  Sum_probs=9.4

Q ss_pred             HHHHHHHHHHHHH
Q 020057          297 VIGVHELGHILAA  309 (331)
Q Consensus       297 ILgvHE~GHylaA  309 (331)
                      ...+||+||-+=+
T Consensus       109 ~~~~HEiGH~lGl  121 (124)
T PF13582_consen  109 DTFAHEIGHNLGL  121 (124)
T ss_dssp             THHHHHHHHHTT-
T ss_pred             eEeeehhhHhcCC
Confidence            4558999998744


No 17 
>cd04267 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADAM_like or reprolysin_like subgroup. The adamalysin_like or ADAM family of metalloproteases contains proteolytic domains from snake venoms, proteases from the mammalian reproductive tract, and the tumor necrosis factor alpha convertase, TACE. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions.
Probab=49.88  E-value=7.4  Score=34.24  Aligned_cols=18  Identities=44%  Similarity=0.639  Sum_probs=13.8

Q ss_pred             HHHHHHHHHHHHHHHHcC
Q 020057          296 LVIGVHELGHILAAKSTG  313 (331)
Q Consensus       296 ~ILgvHE~GHylaArr~g  313 (331)
                      +...+||+||.+=+..-+
T Consensus       134 ~~~~aHElGH~lG~~HD~  151 (192)
T cd04267         134 ALTMAHELGHNLGAEHDG  151 (192)
T ss_pred             hhhhhhhHHhhcCCcCCC
Confidence            456799999999776544


No 18 
>COG5309 Exo-beta-1,3-glucanase [Carbohydrate transport and metabolism]
Probab=49.84  E-value=31  Score=34.36  Aligned_cols=61  Identities=16%  Similarity=0.312  Sum_probs=46.1

Q ss_pred             HhHHHHHhhccccc-ceEEEEeeeeeCCeEEEEcccCC--hHHHHHHHHHHHHHHhcCCceEEEEEec
Q 020057          158 KETIDILKDQVFGF-DTFFVTNQEPYEGGVLFKGNLRG--QAAKTYEKISTRMKNKFGDQYKLFLLVN  222 (331)
Q Consensus       158 ~EdLk~IK~~~FG~-dTFfvT~~e~~~qGVIfRGNLRg--~pEevy~kL~~kLee~fGDrY~LfLvee  222 (331)
                      .|.|++||. .||= .+|||||+-.--.|.-+-++.-.  +..+.++++...|+.. |  |..|+++-
T Consensus       218 ~~q~e~vqs-a~g~~k~~~v~EtGWPS~G~~~G~a~pS~anq~~~~~~i~~~~~~~-G--~d~fvfeA  281 (305)
T COG5309         218 LEQLERVQS-ACGTKKTVWVTETGWPSDGRTYGSAVPSVANQKIAVQEILNALRSC-G--YDVFVFEA  281 (305)
T ss_pred             HHHHHHHHH-hcCCCccEEEeeccCCCCCCccCCcCCChhHHHHHHHHHHhhhhcc-C--ccEEEeee
Confidence            677999998 7776 99999999655555555555433  4678889999999888 9  77787764


No 19 
>COG1994 SpoIVFB Zn-dependent proteases [General function prediction only]
Probab=49.75  E-value=14  Score=34.40  Aligned_cols=41  Identities=24%  Similarity=0.259  Sum_probs=30.9

Q ss_pred             HhhhchhhHHHHHHHHHHHHHHHHHHHHHcCCccccceecc
Q 020057          283 LLTNGLPGALVTALVIGVHELGHILAAKSTGVELGVPYFVP  323 (331)
Q Consensus       283 ~l~~gLP~al~ll~ILgvHE~GHylaArr~gVklSlPyFIP  323 (331)
                      .+.++....++++.-+..||+||+..++++++++-.-.+.+
T Consensus        40 ~~~~~~~~~~~l~~rl~l~~~gh~~~~~~~~~~l~~~~i~~   80 (230)
T COG1994          40 SLGDGTAAFVGLAHRLVLHPLGHSDEAGRLGLKLLLALLFG   80 (230)
T ss_pred             HHhhhHHHHHHHhHHHhhhHhhHHHHHHHHHHHHHHHHHHh
Confidence            34555665555555777999999999999999887766653


No 20 
>PF00413 Peptidase_M10:  Matrixin This Prosite motif covers only the active site.;  InterPro: IPR001818 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M10 (clan MA(M)).  The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. Sequences having this domain are extracellular metalloproteases, such as collagenase and stromelysin, which degrade the extracellular matrix, are known as matrixins. They are zinc-dependent, calcium-activated proteases synthesised as inactive precursors (zymogens), which are proteolytically cleaved to yield the active enzyme [, ]. All matrixins and related proteins possess 2 domains: an N-terminal domain, and a zinc-binding active site domain. The N-terminal domain peptide, cleaved during the activation step, includes a conserved PRCGVPDV octapeptide, known as the cysteine switch, whose Cys residue chelates the active site zinc atom, rendering the enzyme inactive [, ]. The active enzyme degrades components of the extracellular matrix, playing a role in the initial steps of tissue remodelling during morphogenesis, wound healing, angiogenesis and tumour invasion [, ].; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0031012 extracellular matrix; PDB: 1Q3A_C 3V96_B 1HV5_D 1CXV_A 1SRP_A 1FBL_A 1ZVX_A 1JH1_A 1I76_A 2OY4_A ....
Probab=48.85  E-value=11  Score=31.59  Aligned_cols=13  Identities=38%  Similarity=0.889  Sum_probs=9.6

Q ss_pred             HHHHHHHHHHHHH
Q 020057          298 IGVHELGHILAAK  310 (331)
Q Consensus       298 LgvHE~GHylaAr  310 (331)
                      .++|||||-+=-.
T Consensus       108 v~~HEiGHaLGL~  120 (154)
T PF00413_consen  108 VAIHEIGHALGLD  120 (154)
T ss_dssp             HHHHHHHHHTTBE
T ss_pred             hhhhccccccCcC
Confidence            3489999987543


No 21 
>cd04279 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_like sub-family 1. A group of bacterial, archaeal, and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=48.79  E-value=11  Score=32.30  Aligned_cols=20  Identities=35%  Similarity=0.446  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHHHHHcCCcc
Q 020057          297 VIGVHELGHILAAKSTGVEL  316 (331)
Q Consensus       297 ILgvHE~GHylaArr~gVkl  316 (331)
                      -..+|||||-+=.+...-+-
T Consensus       106 ~~~~HEiGHaLGL~H~~~~~  125 (156)
T cd04279         106 AIALHELGHALGLWHHSDRP  125 (156)
T ss_pred             HHHHHHhhhhhcCCCCCCCc
Confidence            34589999999887766653


No 22 
>PF13574 Reprolysin_2:  Metallo-peptidase family M12B Reprolysin-like; PDB: 1KAP_P 1JIW_P 1AKL_A 1OM7_A 1OM8_A 1O0T_A 1OM6_A 1H71_P 1O0Q_A 1OMJ_A ....
Probab=48.56  E-value=7.6  Score=34.48  Aligned_cols=17  Identities=41%  Similarity=0.483  Sum_probs=11.2

Q ss_pred             HHHHHHHHHHHHHHHHc
Q 020057          296 LVIGVHELGHILAAKST  312 (331)
Q Consensus       296 ~ILgvHE~GHylaArr~  312 (331)
                      ....+|||||-|=|..-
T Consensus       112 ~~~~aHElGH~lGa~Hd  128 (173)
T PF13574_consen  112 IDTFAHELGHQLGAPHD  128 (173)
T ss_dssp             HHHHHHHHHHHHT---S
T ss_pred             eeeehhhhHhhcCCCCC
Confidence            34579999999988653


No 23 
>PRK04897 heat shock protein HtpX; Provisional
Probab=47.90  E-value=11  Score=36.34  Aligned_cols=11  Identities=55%  Similarity=0.616  Sum_probs=8.4

Q ss_pred             HHHHHHHHHHHH
Q 020057          296 LVIGVHELGHIL  307 (331)
Q Consensus       296 ~ILgvHE~GHyl  307 (331)
                      +|+ +||+||+-
T Consensus       139 aVl-AHElgHi~  149 (298)
T PRK04897        139 GVI-GHEISHIR  149 (298)
T ss_pred             HHH-HHHHHHHh
Confidence            344 89999974


No 24 
>PRK02870 heat shock protein HtpX; Provisional
Probab=47.77  E-value=10  Score=37.85  Aligned_cols=10  Identities=60%  Similarity=0.959  Sum_probs=7.9

Q ss_pred             HHHHHHHHHHH
Q 020057          296 LVIGVHELGHI  306 (331)
Q Consensus       296 ~ILgvHE~GHy  306 (331)
                      +|+ +||+||+
T Consensus       175 aVl-AHELgHi  184 (336)
T PRK02870        175 AVM-AHELSHI  184 (336)
T ss_pred             HHH-HHHHHHH
Confidence            344 8999998


No 25 
>cd04269 ZnMc_adamalysin_II_like Zinc-dependent metalloprotease; adamalysin_II_like subfamily. Adamalysin II is a snake venom zinc endopeptidase. This subfamily contains other snake venom metalloproteinases, as well as membrane-anchored metalloproteases belonging to the ADAM family. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions.
Probab=47.12  E-value=13  Score=32.82  Aligned_cols=17  Identities=41%  Similarity=0.473  Sum_probs=13.1

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 020057          295 ALVIGVHELGHILAAKS  311 (331)
Q Consensus       295 l~ILgvHE~GHylaArr  311 (331)
                      .++..+||+||-+=+..
T Consensus       131 ~a~~~AHElGH~lG~~H  147 (194)
T cd04269         131 FAVTMAHELGHNLGMEH  147 (194)
T ss_pred             HHHHHHHHHHhhcCCCc
Confidence            35778999999886653


No 26 
>PRK11037 hypothetical protein; Provisional
Probab=46.94  E-value=65  Score=26.66  Aligned_cols=65  Identities=18%  Similarity=0.383  Sum_probs=43.8

Q ss_pred             cccCCCHhHH-----HHHhhcccccceEEEEeeeeeCCeEEEEccc--CC------hHHHHHHHHHHHHHHhcCCceEE
Q 020057          152 EYIRIPKETI-----DILKDQVFGFDTFFVTNQEPYEGGVLFKGNL--RG------QAAKTYEKISTRMKNKFGDQYKL  217 (331)
Q Consensus       152 ~~~~ip~EdL-----k~IK~~~FG~dTFfvT~~e~~~qGVIfRGNL--Rg------~pEevy~kL~~kLee~fGDrY~L  217 (331)
                      +..+|++++|     ++||+.===+...++|+++..++..+|||..  ..      +...||+ +-+.|+-.+..+|.|
T Consensus         4 ~~~~I~~~~LL~~AN~iI~~Hedyi~GM~a~~Veqk~~VLVFkGeyFLD~~GlPT~KtTAvFN-MFK~LAh~LS~~y~L   81 (83)
T PRK11037          4 ETQPIDRETLLLEANKIIREHEDYLAGMRATDVEQKNGVLVFRGEYFLDEQGLPTAKTTAVFN-MFKHLAHVLSEKYHL   81 (83)
T ss_pred             CCcccCHHHHHHHHHHHHHhhHHHhcccccceeeeeCCEEEEecceeecCCCCCCccchHHHH-HHHHHHHHhCcceec
Confidence            4557888887     3555432234457899999999999999983  21      2345554 556677777888884


No 27 
>PRK01345 heat shock protein HtpX; Provisional
Probab=45.60  E-value=13  Score=36.48  Aligned_cols=13  Identities=46%  Similarity=0.644  Sum_probs=9.4

Q ss_pred             HHHHHHHHHHHHHH
Q 020057          294 TALVIGVHELGHIL  307 (331)
Q Consensus       294 ll~ILgvHE~GHyl  307 (331)
                      +.+|+ +||+||+-
T Consensus       124 L~aVl-AHElgHi~  136 (317)
T PRK01345        124 VAGVM-AHELAHVK  136 (317)
T ss_pred             HHHHH-HHHHHHHH
Confidence            33454 89999985


No 28 
>PRK12462 phosphoserine aminotransferase; Provisional
Probab=45.50  E-value=42  Score=33.82  Aligned_cols=66  Identities=12%  Similarity=0.178  Sum_probs=48.3

Q ss_pred             cccccCCCHhHHHHHhhcccccceEEEEeeeeeCCeEEEEcccCChHHHHHHHHHHHHHHhcC--CceEEEEEecC
Q 020057          150 LDEYIRIPKETIDILKDQVFGFDTFFVTNQEPYEGGVLFKGNLRGQAAKTYEKISTRMKNKFG--DQYKLFLLVNP  223 (331)
Q Consensus       150 ~~~~~~ip~EdLk~IK~~~FG~dTFfvT~~e~~~qGVIfRGNLRg~pEevy~kL~~kLee~fG--DrY~LfLvee~  223 (331)
                      ...+..+|+|.|++++.++.-|..        -+-+|+=.+---.+-.++|+++.++|++.|+  +.|.+++++.+
T Consensus         9 ~aGPa~lp~~Vl~~~~~~~~~~~~--------~g~si~eisHRs~~F~~i~~~~~~~Lr~Ll~~P~~y~Vlfl~Gg   76 (364)
T PRK12462          9 SGGPGALPDTVLEQVRQAVVELPE--------TGLSVLGMSHRSSWFSSLLAQAEADLRDLLGIPDEYGVVFLQGG   76 (364)
T ss_pred             cCCCcCCCHHHHHHHHHHHhcccc--------cCccccccccccHHHHHHHHHHHHHHHHHhCCCCCCeEEEEecc
Confidence            456789999999999987544432        1223443333334779999999999999999  68999888864


No 29 
>PF02031 Peptidase_M7:  Streptomyces extracellular neutral proteinase (M7) family;  InterPro: IPR000013 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M7 (snapalysin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. With a molecular weight of around 16kDa, Streptomyces extracellular neutral protease is one of the smallest known proteases []; it is capable of hydrolysing milk proteins []. The enzyme is synthesised as a proenzyme with a signal peptide, a propeptide and an active domain that contains the conserved HEXXH motif characteristic of metalloproteases. Although family M7 shows active site sequence similarity to other members, it differs in one major respect: the third zinc ligand appears to be an aspartate residue rather than the usual histidine.; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0005576 extracellular region; PDB: 1C7K_A 1KUH_A.
Probab=45.10  E-value=13  Score=33.09  Aligned_cols=11  Identities=73%  Similarity=1.189  Sum_probs=8.7

Q ss_pred             HHHHHHHHHHH
Q 020057          298 IGVHELGHILA  308 (331)
Q Consensus       298 LgvHE~GHyla  308 (331)
                      ..+||+||.+-
T Consensus        80 IaaHE~GHiLG   90 (132)
T PF02031_consen   80 IAAHELGHILG   90 (132)
T ss_dssp             HHHHHHHHHHT
T ss_pred             eeeehhccccC
Confidence            45899999863


No 30 
>PRK03072 heat shock protein HtpX; Provisional
Probab=44.54  E-value=14  Score=35.65  Aligned_cols=11  Identities=45%  Similarity=0.655  Sum_probs=8.2

Q ss_pred             HHHHHHHHHHHH
Q 020057          296 LVIGVHELGHIL  307 (331)
Q Consensus       296 ~ILgvHE~GHyl  307 (331)
                      +|+ +||+||+-
T Consensus       129 aVl-AHElgHi~  139 (288)
T PRK03072        129 GVL-GHELSHVY  139 (288)
T ss_pred             HHH-HHHHHHHh
Confidence            344 89999973


No 31 
>cd04275 ZnMc_pappalysin_like Zinc-dependent metalloprotease, pappalysin_like subfamily. The pregnancy-associated plasma protein A (PAPP-A or pappalysin-1) cleaves insulin-like growth factor-binding proteins 4 and 5, thereby promoting cell growth by releasing bound growth factor. This model includes pappalysins and related metalloprotease domains from all three kingdoms of life. The three-dimensional structure of an archaeal representative, ulilysin, has been solved.
Probab=43.05  E-value=4  Score=38.35  Aligned_cols=12  Identities=42%  Similarity=0.659  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHHH
Q 020057          297 VIGVHELGHILA  308 (331)
Q Consensus       297 ILgvHE~GHyla  308 (331)
                      ..++||+|||+-
T Consensus       139 ~t~~HEvGH~lG  150 (225)
T cd04275         139 DTATHEVGHWLG  150 (225)
T ss_pred             ceeEEeccceee
Confidence            456999999974


No 32 
>PRK05457 heat shock protein HtpX; Provisional
Probab=42.79  E-value=15  Score=35.38  Aligned_cols=10  Identities=50%  Similarity=0.929  Sum_probs=7.8

Q ss_pred             HHHHHHHHHHH
Q 020057          296 LVIGVHELGHI  306 (331)
Q Consensus       296 ~ILgvHE~GHy  306 (331)
                      +|+ +||+||+
T Consensus       136 aVl-AHElgHi  145 (284)
T PRK05457        136 AVL-AHEISHI  145 (284)
T ss_pred             HHH-HHHHHHH
Confidence            344 8999997


No 33 
>KOG2719 consensus Metalloprotease [General function prediction only]
Probab=42.44  E-value=14  Score=38.37  Aligned_cols=12  Identities=50%  Similarity=0.728  Sum_probs=8.8

Q ss_pred             HHHHHHHHHHHHH
Q 020057          296 LVIGVHELGHILA  308 (331)
Q Consensus       296 ~ILgvHE~GHyla  308 (331)
                      +|| +||+|||-.
T Consensus       282 AVl-~HELGHW~~  293 (428)
T KOG2719|consen  282 AVL-AHELGHWKL  293 (428)
T ss_pred             HHH-HHHhhHHHH
Confidence            344 899999853


No 34 
>COG2856 Predicted Zn peptidase [Amino acid transport and metabolism]
Probab=42.34  E-value=13  Score=34.88  Aligned_cols=14  Identities=43%  Similarity=0.534  Sum_probs=10.8

Q ss_pred             HHHHHHHHHHHHHc
Q 020057          299 GVHELGHILAAKST  312 (331)
Q Consensus       299 gvHE~GHylaArr~  312 (331)
                      .+||+||+|.=++-
T Consensus        76 lAHELGH~llH~~~   89 (213)
T COG2856          76 LAHELGHALLHTDL   89 (213)
T ss_pred             HHHHHhHHHhcccc
Confidence            38999999975543


No 35 
>PRK02391 heat shock protein HtpX; Provisional
Probab=42.12  E-value=16  Score=35.53  Aligned_cols=10  Identities=50%  Similarity=0.939  Sum_probs=7.8

Q ss_pred             HHHHHHHHHHH
Q 020057          296 LVIGVHELGHI  306 (331)
Q Consensus       296 ~ILgvHE~GHy  306 (331)
                      +|+ +||+||+
T Consensus       135 aVl-aHElgHi  144 (296)
T PRK02391        135 AVL-AHELSHV  144 (296)
T ss_pred             HHH-HHHHHHH
Confidence            344 8999996


No 36 
>PLN02452 phosphoserine transaminase
Probab=41.61  E-value=58  Score=32.48  Aligned_cols=67  Identities=9%  Similarity=0.186  Sum_probs=50.6

Q ss_pred             CcccccCCCHhHHHHHhhcccccceEEEEeeeeeCCeEEEEcccCChHHHHHHHHHHHHHHhcC--CceEEEEEecC
Q 020057          149 QLDEYIRIPKETIDILKDQVFGFDTFFVTNQEPYEGGVLFKGNLRGQAAKTYEKISTRMKNKFG--DQYKLFLLVNP  223 (331)
Q Consensus       149 ~~~~~~~ip~EdLk~IK~~~FG~dTFfvT~~e~~~qGVIfRGNLRg~pEevy~kL~~kLee~fG--DrY~LfLvee~  223 (331)
                      ....+..+|++.+++++.+++.|.        -.+-+++-.+---.+=.++++.++++|++.++  +.|.+++++.+
T Consensus        11 f~pGP~~lp~~Vl~~~~~~~~~~~--------~~g~s~~~~sHRs~~f~~i~~~~~~~L~~l~~~p~~y~v~~l~Gs   79 (365)
T PLN02452         11 FSAGPATLPANVLAKAQAELYNWE--------GSGMSVMEMSHRGKEFLSIIQKAEADLRELLDIPDNYEVLFLQGG   79 (365)
T ss_pred             eeCCCCCCCHHHHHHHHHHHhccc--------ccCccccccCCCchHHHHHHHHHHHHHHHHhCCCCCceEEEEeCc
Confidence            355688999999999998755443        22445655555445678999999999999998  67998888765


No 37 
>PF10692 DUF2498:  Protein of unknown function (DUF2498);  InterPro: IPR019633  This entry represents proteins found in gammaproteobacteria, including YciN from Escherichia coli. Their function is not known. ; PDB: 3M92_A.
Probab=41.45  E-value=83  Score=26.01  Aligned_cols=64  Identities=14%  Similarity=0.304  Sum_probs=38.2

Q ss_pred             ccCCCHhHH-----HHHhhcccccceEEEEeeeeeCCeEEEEccc--CC------hHHHHHHHHHHHHHHhcCCceEE
Q 020057          153 YIRIPKETI-----DILKDQVFGFDTFFVTNQEPYEGGVLFKGNL--RG------QAAKTYEKISTRMKNKFGDQYKL  217 (331)
Q Consensus       153 ~~~ip~EdL-----k~IK~~~FG~dTFfvT~~e~~~qGVIfRGNL--Rg------~pEevy~kL~~kLee~fGDrY~L  217 (331)
                      ..+|++++|     ++||+.===+....+|+++..++..+|||+.  ..      +...||+ +-+.|+-.+..||.|
T Consensus         4 ~~~I~~~~LL~~AN~iI~~Hddyi~GM~a~~Veqk~~VLVFkGeyFLD~~GlPT~KtTAvFN-mFK~LAh~LS~~y~L   80 (82)
T PF10692_consen    4 KQPISRQALLEIANQIIREHDDYIHGMRATSVEQKGDVLVFKGEYFLDEQGLPTAKTTAVFN-MFKHLAHVLSEKYHL   80 (82)
T ss_dssp             SEEE-HHHHHHHHHHHHHHHHHHHTT--EEEEEECTTEEEEEE-----TTS---HHHHHHHH-HHHHHHHHHCCCEEE
T ss_pred             CcccCHHHHHHHHHHHHHhhHhhhccccccceeeECCEEEEecceeecCCCCCCcchHHHHH-HHHHHHHHcCcceEe
Confidence            345666665     3444321123346799999999999999983  22      2344554 567777788889984


No 38 
>PRK01265 heat shock protein HtpX; Provisional
Probab=40.99  E-value=17  Score=36.16  Aligned_cols=10  Identities=60%  Similarity=0.903  Sum_probs=7.8

Q ss_pred             HHHHHHHHHHH
Q 020057          296 LVIGVHELGHI  306 (331)
Q Consensus       296 ~ILgvHE~GHy  306 (331)
                      +|+ +||+||+
T Consensus       142 aVl-AHElgHi  151 (324)
T PRK01265        142 AVA-GHELGHL  151 (324)
T ss_pred             HHH-HHHHHHH
Confidence            344 8999996


No 39 
>cd00203 ZnMc Zinc-dependent metalloprotease. This super-family of metalloproteases contains two major branches, the astacin-like proteases and the adamalysin/reprolysin-like proteases. Both branches have wide phylogenetic distribution, and contain sub-families, which are involved in vertebrate development and disease.
Probab=40.57  E-value=14  Score=31.12  Aligned_cols=17  Identities=35%  Similarity=0.356  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 020057          295 ALVIGVHELGHILAAKS  311 (331)
Q Consensus       295 l~ILgvHE~GHylaArr  311 (331)
                      .....+||+||-+=.+.
T Consensus        96 ~~~~~~HElGH~LGl~H  112 (167)
T cd00203          96 GAQTIAHELGHALGFYH  112 (167)
T ss_pred             chhhHHHHHHHHhCCCc
Confidence            34566899999986553


No 40 
>COG3824 Predicted Zn-dependent protease [General function prediction only]
Probab=39.61  E-value=13  Score=32.99  Aligned_cols=18  Identities=11%  Similarity=0.488  Sum_probs=13.6

Q ss_pred             HHHHHHHHHHHHHHhcCC
Q 020057          196 AAKTYEKISTRMKNKFGD  213 (331)
Q Consensus       196 pEevy~kL~~kLee~fGD  213 (331)
                      ..++|..|-+.++.+.|+
T Consensus        21 a~~A~d~lP~efr~l~~~   38 (136)
T COG3824          21 ASDALDHLPQEFRDLMGN   38 (136)
T ss_pred             HHHHHHhCcHHHHHHhcC
Confidence            356788888888888774


No 41 
>PF04315 DUF462:  Protein of unknown function, DUF462;  InterPro: IPR007411 This family consists of bacterial proteins of uncharacterised function.
Probab=39.35  E-value=16  Score=33.52  Aligned_cols=11  Identities=36%  Similarity=0.591  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHH
Q 020057          299 GVHELGHILAA  309 (331)
Q Consensus       299 gvHE~GHylaA  309 (331)
                      +.||++||-.|
T Consensus        45 ALHEIaHWciA   55 (164)
T PF04315_consen   45 ALHEIAHWCIA   55 (164)
T ss_pred             HHHHHHHHHhc
Confidence            36999999998


No 42 
>PF01434 Peptidase_M41:  Peptidase family M41 This is family M41 in the peptidase classification. ;  InterPro: IPR000642 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M41 (FtsH endopeptidase family, clan MA(E)). The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH. The peptidase M41 family belong to a larger family of zinc metalloproteases. This family includes the cell division protein FtsH, and the yeast mitochondrial respiratory chain complexes assembly protein, which is a putative ATP-dependent protease required for assembly of the mitochondrial respiratory chain and ATPase complexes. FtsH is an integral membrane protein, which seems to act as an ATP-dependent zinc metallopeptidase that binds one zinc ion.; GO: 0004222 metalloendopeptidase activity, 0005524 ATP binding, 0006508 proteolysis; PDB: 4EIW_C 2DHR_E 1IY1_A 1IY2_A 1IY0_A 1IXZ_A 2CE7_F 2CEA_F 3KDS_E 2QZ4_A ....
Probab=36.12  E-value=25  Score=32.23  Aligned_cols=18  Identities=33%  Similarity=0.309  Sum_probs=15.2

Q ss_pred             HHHHHHHHHHHHHHHHcC
Q 020057          296 LVIGVHELGHILAAKSTG  313 (331)
Q Consensus       296 ~ILgvHE~GHylaArr~g  313 (331)
                      -++++||.||-++|-...
T Consensus        29 ~~~A~HEAGhAvva~~l~   46 (213)
T PF01434_consen   29 RRIAYHEAGHAVVAYLLP   46 (213)
T ss_dssp             HHHHHHHHHHHHHHHHSS
T ss_pred             HHHHHHHHHHHHHHHHhc
Confidence            478899999999998654


No 43 
>PF13699 DUF4157:  Domain of unknown function (DUF4157)
Probab=35.74  E-value=22  Score=28.25  Aligned_cols=12  Identities=33%  Similarity=0.642  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHHH
Q 020057          298 IGVHELGHILAA  309 (331)
Q Consensus       298 LgvHE~GHylaA  309 (331)
                      |.+||+.|.+.=
T Consensus        64 llaHEl~Hv~Qq   75 (79)
T PF13699_consen   64 LLAHELAHVVQQ   75 (79)
T ss_pred             hHhHHHHHHHhh
Confidence            559999999864


No 44 
>PF01421 Reprolysin:  Reprolysin (M12B) family zinc metalloprotease  This Prosite motif covers only the active site.;  InterPro: IPR001590 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M12, subfamily M12B (adamalysin family, clan (MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The adamalysins are zinc dependent endopeptidases found in snake venom. There are some mammalian proteins such as P78325 from SWISSPROT, and fertilin Q28472 from SWISSPROT. Fertilin and closely related proteins appear to not have some active site residues and may not be active enzymes. CD156 (also called ADAM8 (3.4.24 from EC) or MS2 human) has been implicated in extravasation of leukocytes. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2E3X_A 2W15_A 2W14_A 2W13_A 2W12_A 1ND1_A 3K7L_A 2DW2_A 2DW0_B 2DW1_A ....
Probab=35.56  E-value=26  Score=31.07  Aligned_cols=21  Identities=43%  Similarity=0.569  Sum_probs=12.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHcC
Q 020057          293 VTALVIGVHELGHILAAKSTG  313 (331)
Q Consensus       293 ~ll~ILgvHE~GHylaArr~g  313 (331)
                      ...+...+||+||-+=...-+
T Consensus       129 ~~~a~~~AHelGH~lGm~HD~  149 (199)
T PF01421_consen  129 LSFAVIIAHELGHNLGMPHDG  149 (199)
T ss_dssp             HHHHHHHHHHHHHHTT---TT
T ss_pred             HHHHHHHHHHHHHhcCCCCCC
Confidence            334566699999987554433


No 45 
>PF12046 DUF3529:  Protein of unknown function (DUF3529);  InterPro: IPR021919  This family of proteins is functionally uncharacterised. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 176 to 190 amino acids in length. 
Probab=34.91  E-value=1.9e+02  Score=26.85  Aligned_cols=20  Identities=10%  Similarity=0.400  Sum_probs=18.3

Q ss_pred             ChHHHHHHHHHHHHHHhcCCceE
Q 020057          194 GQAAKTYEKISTRMKNKFGDQYK  216 (331)
Q Consensus       194 g~pEevy~kL~~kLee~fGDrY~  216 (331)
                      ++++++-+.|++.++++ |  |+
T Consensus        40 ~p~~~~~~~l~~yf~~r-~--y~   59 (173)
T PF12046_consen   40 QPPDEVLEQLKAYFEQR-N--YR   59 (173)
T ss_pred             CCHHHHHHHHHHHHHhc-C--ce
Confidence            46999999999999999 8  88


No 46 
>smart00235 ZnMc Zinc-dependent metalloprotease. Neutral zinc metallopeptidases. This alignment represents a subset of known subfamilies. Highest similarity occurs in the HExxH zinc-binding site/ active site.
Probab=34.57  E-value=21  Score=29.77  Aligned_cols=13  Identities=46%  Similarity=0.777  Sum_probs=10.0

Q ss_pred             HHHHHHHHHHHHH
Q 020057          298 IGVHELGHILAAK  310 (331)
Q Consensus       298 LgvHE~GHylaAr  310 (331)
                      ..+|||||-+=..
T Consensus        89 ~~~HEigHaLGl~  101 (140)
T smart00235       89 VAAHELGHALGLY  101 (140)
T ss_pred             cHHHHHHHHhcCC
Confidence            3589999988544


No 47 
>cd04270 ZnMc_TACE_like Zinc-dependent metalloprotease; TACE_like subfamily. TACE, the tumor-necrosis factor-alpha converting enzyme, releases soluble TNF-alpha from transmembrane pro-TNF-alpha.
Probab=33.51  E-value=26  Score=32.86  Aligned_cols=17  Identities=29%  Similarity=0.534  Sum_probs=13.1

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 020057          295 ALVIGVHELGHILAAKS  311 (331)
Q Consensus       295 l~ILgvHE~GHylaArr  311 (331)
                      .++..+|||||-|=+..
T Consensus       167 ~a~t~AHElGHnlGm~H  183 (244)
T cd04270         167 SDLVTAHELGHNFGSPH  183 (244)
T ss_pred             HHHHHHHHHHHhcCCCC
Confidence            45667999999887653


No 48 
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily. This group contains matrix metalloproteinases (MMPs), serralysins, and the astacin_like family of proteases.
Probab=33.33  E-value=39  Score=28.59  Aligned_cols=15  Identities=40%  Similarity=0.556  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHHHHHH
Q 020057          296 LVIGVHELGHILAAK  310 (331)
Q Consensus       296 ~ILgvHE~GHylaAr  310 (331)
                      .-..+|||||-+=-.
T Consensus        95 ~~~~~HEiGHaLGL~  109 (165)
T cd04268          95 RNTAEHELGHALGLR  109 (165)
T ss_pred             HHHHHHHHHHHhccc
Confidence            344589999987443


No 49 
>PF13583 Reprolysin_4:  Metallo-peptidase family M12B Reprolysin-like
Probab=32.09  E-value=23  Score=32.46  Aligned_cols=15  Identities=33%  Similarity=0.394  Sum_probs=11.8

Q ss_pred             HHHHHHHHHHHHHcC
Q 020057          299 GVHELGHILAAKSTG  313 (331)
Q Consensus       299 gvHE~GHylaArr~g  313 (331)
                      .+||+||-+=|+.-+
T Consensus       141 ~aHEiGH~lGl~H~~  155 (206)
T PF13583_consen  141 FAHEIGHNLGLRHDF  155 (206)
T ss_pred             HHHHHHHHhcCCCCc
Confidence            689999999876443


No 50 
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]
Probab=31.98  E-value=48  Score=38.19  Aligned_cols=15  Identities=27%  Similarity=0.414  Sum_probs=6.5

Q ss_pred             cccccccccCCCCcc
Q 020057            5 TTFRGNLSLLPHCSS   19 (331)
Q Consensus         5 ~~~~~~~~~~~~~~~   19 (331)
                      +||-|.-..+--|++
T Consensus      1354 aTi~v~R~~~Dlct~ 1368 (1516)
T KOG1832|consen 1354 ATIPVDRCLLDLCTE 1368 (1516)
T ss_pred             eeeecccchhhhhcC
Confidence            344444344444544


No 51 
>cd04277 ZnMc_serralysin_like Zinc-dependent metalloprotease, serralysin_like subfamily. Serralysins and related proteases are important virulence factors in pathogenic bacteria. They may be secreted into the medium via a mechanism found in gram-negative bacteria, that does not require n-terminal signal sequences which are cleaved after the transmembrane translocation. A calcium-binding domain c-terminal to the metalloprotease domain, which contains multiple tandem repeats of a nine-residue motif including the pattern GGxGxD, and which forms a parallel beta roll may be involved in the translocation mechanism and/or substrate binding. Serralysin family members may have a broad spectrum of substrates each, including host immunoglobulins, complement proteins, cell matrix and cytoskeletal proteins, as well as antimicrobial peptides.
Probab=31.19  E-value=25  Score=30.94  Aligned_cols=14  Identities=36%  Similarity=0.601  Sum_probs=10.2

Q ss_pred             HHHHHHHHHHHHHH
Q 020057          297 VIGVHELGHILAAK  310 (331)
Q Consensus       297 ILgvHE~GHylaAr  310 (331)
                      -..+||+||-+=-+
T Consensus       115 ~t~~HEiGHaLGL~  128 (186)
T cd04277         115 QTIIHEIGHALGLE  128 (186)
T ss_pred             HHHHHHHHHHhcCC
Confidence            44579999987543


No 52 
>PF04228 Zn_peptidase:  Putative neutral zinc metallopeptidase;  InterPro: IPR007343 Members of this family of bacterial proteins are described as hypothetical proteins or zinc metallopeptidases. The majority have a HExxH zinc-binding motif characteristic of neutral zinc metallopeptidases, however there is no evidence to support their function as metallopeptidases.
Probab=31.14  E-value=41  Score=33.08  Aligned_cols=12  Identities=33%  Similarity=0.415  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHHH
Q 020057          299 GVHELGHILAAK  310 (331)
Q Consensus       299 gvHE~GHylaAr  310 (331)
                      .+||.||.+...
T Consensus       174 lAHEyGHHVQ~l  185 (292)
T PF04228_consen  174 LAHEYGHHVQNL  185 (292)
T ss_pred             HHHHHHHHHHHH
Confidence            499999998754


No 53 
>cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family. MMPs are responsible for a great deal of pericellular proteolysis of extracellular matrix and cell surface molecules, playing crucial roles in morphogenesis, cell fate specification, cell migration, tissue repair, tumorigenesis, gain or loss of tissue-specific functions, and apoptosis. In many instances, they are anchored to cell membranes via trans-membrane domains, and their activity is controlled via TIMPs (tissue inhibitors of metalloproteinases).
Probab=30.97  E-value=22  Score=30.48  Aligned_cols=13  Identities=38%  Similarity=0.772  Sum_probs=10.0

Q ss_pred             HHHHHHHHHHHHH
Q 020057          298 IGVHELGHILAAK  310 (331)
Q Consensus       298 LgvHE~GHylaAr  310 (331)
                      .+.|||||-+=-.
T Consensus       110 ~~~HEiGHaLGL~  122 (157)
T cd04278         110 VAAHEIGHALGLG  122 (157)
T ss_pred             HHHHHhccccccC
Confidence            3489999987654


No 54 
>PF15281 Consortin_C:  Consortin C-terminus
Probab=30.19  E-value=1.1e+02  Score=26.76  Aligned_cols=12  Identities=42%  Similarity=0.537  Sum_probs=9.6

Q ss_pred             HHHHHHHHHHHH
Q 020057          297 VIGVHELGHILA  308 (331)
Q Consensus       297 ILgvHE~GHyla  308 (331)
                      -.++||+-||+.
T Consensus       101 ~q~~~~l~hW~~  112 (113)
T PF15281_consen  101 KQGLAELKHWLT  112 (113)
T ss_pred             HHHHHHhhhhhc
Confidence            456899999985


No 55 
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=29.30  E-value=31  Score=29.31  Aligned_cols=11  Identities=36%  Similarity=0.440  Sum_probs=9.4

Q ss_pred             HHHHHHHHHHH
Q 020057          299 GVHELGHILAA  309 (331)
Q Consensus       299 gvHE~GHylaA  309 (331)
                      ..|||.|+++-
T Consensus        64 L~HEm~H~~~~   74 (157)
T PF10263_consen   64 LLHEMAHAAAY   74 (157)
T ss_pred             HHHHHHHHHhh
Confidence            38999999984


No 56 
>cd04272 ZnMc_salivary_gland_MPs Zinc-dependent metalloprotease, salivary_gland_MPs. Metalloproteases secreted by the salivary glands of arthropods.
Probab=28.73  E-value=34  Score=31.11  Aligned_cols=18  Identities=39%  Similarity=0.597  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHHHHHHHcC
Q 020057          296 LVIGVHELGHILAAKSTG  313 (331)
Q Consensus       296 ~ILgvHE~GHylaArr~g  313 (331)
                      +...+||+||-+=+..-+
T Consensus       146 ~~~~AHElGH~lG~~HD~  163 (220)
T cd04272         146 VYTMTHELAHLLGAPHDG  163 (220)
T ss_pred             HHHHHHHHHHHhCCCCCC
Confidence            366799999998666443


No 57 
>PF01990 ATP-synt_F:  ATP synthase (F/14-kDa) subunit;  InterPro: IPR008218 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   The V-ATPases (or V1V0-ATPase) and A-ATPases (or A1A0-ATPase) are each composed of two linked complexes: the V1 or A1 complex contains the catalytic core that hydrolyses/synthesizes ATP, and the V0 or A0 complex that forms the membrane-spanning pore. The V- and A-ATPases both contain rotary motors, one that drives proton translocation across the membrane and one that drives ATP synthesis/hydrolysis [, , ]. The V- and A-ATPases more closely resemble one another in subunit structure than they do the F-ATPases, although the function of A-ATPases is closer to that of F-ATPases.  This entry represents subunit F found in the V1 complex of V-ATPases (both eukaryotic and bacterial), as well as in the A1 complex of A-ATPases. Subunit F is a 16 kDa protein that is required for the assembly and activity of V-ATPase, and has a potential role in the differential targeting and regulation of the enzyme for specific organelles. This subunit is not necessary for the rotation of the ATPase V1 rotor, but it does promote catalysis []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0046933 hydrogen ion transporting ATP synthase activity, rotational mechanism, 0046961 proton-transporting ATPase activity, rotational mechanism, 0015991 ATP hydrolysis coupled proton transport, 0033178 proton-transporting two-sector ATPase complex, catalytic domain; PDB: 2D00_E 3A5C_P 3J0J_H 3A5D_H 2OV6_A 2QAI_B 3AON_B 2I4R_A.
Probab=27.61  E-value=2.8e+02  Score=22.08  Aligned_cols=51  Identities=18%  Similarity=0.413  Sum_probs=35.5

Q ss_pred             ccccceEEEEeeeeeCCeEEEEcccCChHHHHHHHHHHHHHHhcCCceEEEEEecC--------------CCCCceEEEe
Q 020057          168 VFGFDTFFVTNQEPYEGGVLFKGNLRGQAAKTYEKISTRMKNKFGDQYKLFLLVNP--------------EDDKPVAVVV  233 (331)
Q Consensus       168 ~FG~dTFfvT~~e~~~qGVIfRGNLRg~pEevy~kL~~kLee~fGDrY~LfLvee~--------------edgKPV~vVl  233 (331)
                      ..|++++++.                .+++++.+.+++-+++. .  |-+.++.+.              ....|+++.+
T Consensus        15 LaGv~~~~~~----------------~~~ee~~~~l~~l~~~~-~--~gIIii~e~~~~~~~~~l~~~~~~~~~P~iv~I   75 (95)
T PF01990_consen   15 LAGVEGVYVN----------------TDPEEAEEALKELLKDE-D--VGIIIITEDLAEKIRDELDEYREESSLPLIVEI   75 (95)
T ss_dssp             HTTSEEEEES----------------HSHHHHHHHHHHHHHHT-T--EEEEEEEHHHHTTHHHHHHHHHHTSSSSEEEEE
T ss_pred             HcCCCCccCC----------------CCHHHHHHHHHHHhcCC-C--ccEEEeeHHHHHHHHHHHHHHHhccCCceEEEc
Confidence            5677777664                57778887777777544 3  666666653              1357999999


Q ss_pred             cCCC
Q 020057          234 PRKT  237 (331)
Q Consensus       234 P~~~  237 (331)
                      |...
T Consensus        76 P~~~   79 (95)
T PF01990_consen   76 PSKE   79 (95)
T ss_dssp             STTC
T ss_pred             CCCC
Confidence            9986


No 58 
>PF08002 DUF1697:  Protein of unknown function (DUF1697);  InterPro: IPR012545 This family contains many hypothetical bacterial proteins.; PDB: 2HIY_B.
Probab=26.86  E-value=1.3e+02  Score=26.06  Aligned_cols=57  Identities=23%  Similarity=0.405  Sum_probs=35.9

Q ss_pred             cCCCHhHHHHHhhcccccceEEEEeeeee-CCe-EEEEcccCChHHHHHHHHHHHHHHhcCCceEEE
Q 020057          154 IRIPKETIDILKDQVFGFDTFFVTNQEPY-EGG-VLFKGNLRGQAAKTYEKISTRMKNKFGDQYKLF  218 (331)
Q Consensus       154 ~~ip~EdLk~IK~~~FG~dTFfvT~~e~~-~qG-VIfRGNLRg~pEevy~kL~~kLee~fGDrY~Lf  218 (331)
                      -+|+-+||+.+=.++ |     .+++.-| +-| |+|.  -..+++++=.+|.+.|+++||-.-.++
T Consensus        17 nki~MaeLr~~l~~~-G-----f~~V~Tyi~SGNvvf~--~~~~~~~l~~~ie~~l~~~fG~~v~v~   75 (137)
T PF08002_consen   17 NKIKMAELREALEDL-G-----FTNVRTYIQSGNVVFE--SDRDPAELAAKIEKALEERFGFDVPVI   75 (137)
T ss_dssp             S---HHHHHHHHHHC-T------EEEEEETTTTEEEEE--ESS-HHHHHHHHHHHHHHH-TT---EE
T ss_pred             CcccHHHHHHHHHHc-C-----CCCceEEEeeCCEEEe--cCCChHHHHHHHHHHHHHhcCCCeEEE
Confidence            467888887655432 3     3788755 444 9999  667899999999999999999544433


No 59 
>PF08800 VirE_N:  VirE N-terminal domain;  InterPro: IPR014907 This domain is associated with the N terminus of Virulence E proteins. The function of the domain is unknown. 
Probab=26.67  E-value=2e+02  Score=24.78  Aligned_cols=59  Identities=15%  Similarity=0.201  Sum_probs=42.2

Q ss_pred             cCCCHhHHHHHhhcccccceEEEEeeeeeCCe--EEEEcccCChH-------------HHHHHHHHHHHHHhcC
Q 020057          154 IRIPKETIDILKDQVFGFDTFFVTNQEPYEGG--VLFKGNLRGQA-------------AKTYEKISTRMKNKFG  212 (331)
Q Consensus       154 ~~ip~EdLk~IK~~~FG~dTFfvT~~e~~~qG--VIfRGNLRg~p-------------Eevy~kL~~kLee~fG  212 (331)
                      -.+++|+++.+|..++.-.-.++.=+-+.+.|  ++++-......             ..+|+.+.+..++.+|
T Consensus        39 D~l~~ee~~~~r~~l~~~p~t~~~f~SpSG~GvKi~v~~~~~~~~~lp~~~~~~~~~h~~~y~~~~~~y~~~~~  112 (136)
T PF08800_consen   39 DHLDPEEAEELRQLLFEDPYTLAAFVSPSGRGVKIIVPFDYPDGSRLPQDEEEAELFHAHAYEAAVEYYQRLLG  112 (136)
T ss_pred             CCCCHHHHHHHHHHHhcCCcEEEEEEcCCCCeEEEEEEecCCCCccccchhHHHHHHHHHHHHHHHHHHhhhcC
Confidence            34558899999987776665567777777777  56665544433             5788888888888877


No 60 
>TIGR02500 type_III_yscD type III secretion apparatus protein, YscD/HrpQ family. This family represents a conserved protein of bacterial type III secretion systems. Gene symbols are variable from species to species. Members are designated YscD in Yersinia, HrpQ in Pseudomonas syringae, and EscD in enteropathogenic Escherichia coli. In the Chlamydiae, this model describes the C-terminal 400 residues of a longer protein.
Probab=26.17  E-value=1.6e+02  Score=29.90  Aligned_cols=39  Identities=13%  Similarity=0.202  Sum_probs=34.6

Q ss_pred             eeCCeEEEEcccCChHHHHHHHHHHHHHHhcCCceEEEE
Q 020057          181 PYEGGVLFKGNLRGQAAKTYEKISTRMKNKFGDQYKLFL  219 (331)
Q Consensus       181 ~~~qGVIfRGNLRg~pEevy~kL~~kLee~fGDrY~LfL  219 (331)
                      ..++.+...|.|..+..+.|+++.+.++++||..|.+.+
T Consensus       302 ~~~~~i~lsG~l~~~~~~~~~~~l~~f~~~~~~~~~~~~  340 (410)
T TIGR02500       302 ESGREIALSGQLDSEKRSRLQELLAAFKQRDGVIPDVVL  340 (410)
T ss_pred             ecCCEEEEEecCCHHHHHHHHHHHHHHHHhCCCCceEEE
Confidence            446789999999999999999999999999998787664


No 61 
>PF14891 Peptidase_M91:  Effector protein
Probab=25.65  E-value=46  Score=29.64  Aligned_cols=16  Identities=31%  Similarity=0.299  Sum_probs=12.3

Q ss_pred             HHHHHHHHHHHHHHHH
Q 020057          296 LVIGVHELGHILAAKS  311 (331)
Q Consensus       296 ~ILgvHE~GHylaArr  311 (331)
                      ++.+.|||+|-|-...
T Consensus       104 ~v~L~HEL~HA~~~~~  119 (174)
T PF14891_consen  104 FVVLYHELIHAYDYMN  119 (174)
T ss_pred             HHHHHHHHHHHHHHHC
Confidence            4667999999887653


No 62 
>PTZ00429 beta-adaptin; Provisional
Probab=25.43  E-value=88  Score=34.66  Aligned_cols=32  Identities=28%  Similarity=0.251  Sum_probs=14.8

Q ss_pred             ChhhhhhccCCCCCCCCcccccCCCCCCCCcC
Q 020057           75 NDKEKEVHDGQENQPATASDQEDDKSQPDSQL  106 (331)
Q Consensus        75 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  106 (331)
                      .|||++|+++.++.+++.++...+++..+|++
T Consensus       608 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  639 (746)
T PTZ00429        608 LDEEDTEDDDAVELPSTPSMGTQDGSPAPSAA  639 (746)
T ss_pred             cccccccchhhccCCCCCCCCCCCCCCCcccc
Confidence            33444444444455555555444444333443


No 63 
>PHA02456 zinc metallopeptidase motif-containing protein
Probab=24.22  E-value=46  Score=29.45  Aligned_cols=23  Identities=22%  Similarity=0.345  Sum_probs=17.7

Q ss_pred             HHHHHHHHHHHHHcCCc--ccccee
Q 020057          299 GVHELGHILAAKSTGVE--LGVPYF  321 (331)
Q Consensus       299 gvHE~GHylaArr~gVk--lSlPyF  321 (331)
                      ..||+.|.|.-|.||.-  ++.||.
T Consensus        83 L~HEL~H~WQ~RsYG~i~PITY~F~  107 (141)
T PHA02456         83 LAHELNHAWQFRTYGLVQPITYAFS  107 (141)
T ss_pred             HHHHHHHHHhhhccceeeeeehhhh
Confidence            37999999999999964  344443


No 64 
>cd04927 ACT_ACR-like_2 Second  ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). This CD includes the second  ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) have been described, however, the ACR-like sequences in this CD are distinct from those characterized. This CD includes the Oryza sativa ACR-like protein (Os05g0113000) encoded on chromosome 5 and the Arabidopsis thaliana  predicted gene product, At2g39570. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=23.89  E-value=99  Score=23.82  Aligned_cols=34  Identities=24%  Similarity=0.307  Sum_probs=23.3

Q ss_pred             cccceEEEEeeeeeCCeEEEEcccCChHHHHHHHHHHHHHHhcCC
Q 020057          169 FGFDTFFVTNQEPYEGGVLFKGNLRGQAAKTYEKISTRMKNKFGD  213 (331)
Q Consensus       169 FG~dTFfvT~~e~~~qGVIfRGNLRg~pEevy~kL~~kLee~fGD  213 (331)
                      .-+|+|||++-    ++     .  ...++..++|++.|.+.+|+
T Consensus        40 ~v~D~F~V~d~----~~-----~--~~~~~~~~~l~~~L~~~L~~   73 (76)
T cd04927          40 RVLDLFFITDA----RE-----L--LHTKKRREETYDYLRAVLGD   73 (76)
T ss_pred             EEEEEEEEeCC----CC-----C--CCCHHHHHHHHHHHHHHHch
Confidence            35688998642    11     1  13456778899999999885


No 65 
>PF05683 Fumerase_C:  Fumarase C-terminus;  InterPro: IPR004647 This entry represents various Fe-S type hydro-lyases, including the beta subunit from both L-tartrate dehydratase (TtdB; EC:4.2.1.32) and class 2 fumarate hydratase (FumC; (4.2.1.2 from EC) []. A number of Fe-S cluster-containing hydro-lyases share a conserved motif, including argininosuccinate lyase, adenylosuccinate lyase, aspartase, class I fumarate hydratase (fumarase), and tartrate dehydratase (see IPR000362 from INTERPRO). Proteins in this group represent a subset of closely related proteins or modules, including the Escherichia coli tartrate dehydratase beta chain and the C-terminal region of the class I fumarase (where the N-terminal region is homologous to the tartrate dehydratase alpha chain). The activity of the archaeal proteins in this group is unknown.; GO: 0016836 hydro-lyase activity; PDB: 2ISB_A.
Probab=23.70  E-value=1.1e+02  Score=29.15  Aligned_cols=43  Identities=16%  Similarity=0.179  Sum_probs=30.2

Q ss_pred             cccCCCHhHHHHHhhcccccceEEEEeeeeeCCeEEEEcccCChHHHHHHHHHHHHHHh
Q 020057          152 EYIRIPKETIDILKDQVFGFDTFFVTNQEPYEGGVLFKGNLRGQAAKTYEKISTRMKNK  210 (331)
Q Consensus       152 ~~~~ip~EdLk~IK~~~FG~dTFfvT~~e~~~qGVIfRGNLRg~pEevy~kL~~kLee~  210 (331)
                      =..|+.+|+++.||-                ++-|...|.+-.-++.+|++|.+.|++-
T Consensus        31 L~tPlt~e~i~~L~v----------------GD~V~LsG~i~taRDaaH~ri~e~l~~g   73 (205)
T PF05683_consen   31 LTTPLTEEDIRKLKV----------------GDTVYLSGTIYTARDAAHKRIVELLERG   73 (205)
T ss_dssp             EESS--HHHHHH--T----------------T-EEEEEEEEEE--HHHHHHHHHHHHHT
T ss_pred             cCCCCCHHHHhhCCC----------------CCEEEEeeEEEEEhHHHHHHHHHHHHcC
Confidence            356899999999995                6777888888888899999999999865


No 66 
>PF01431 Peptidase_M13:  Peptidase family M13 This is family M13 in the peptidase classification. ;  InterPro: IPR018497 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M13 (neprilysin family, clan MA(E)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. M13 peptidases are well-studied proteases found in a wide range of organisms including mammals and bacteria. In mammals they participate in processes such as cardiovascular development, blood-pressure regulation, nervous control of respiration, and regulation of the function of neuropeptides in the central nervous system. In bacteria they may be used for digestion of milk [, ]. The family includes eukaryotic and prokaryotic oligopeptidases, as well as some of the proteins responsible for the molecular basis of the blood group antigens e.g. Kell [].  Neprilysin (3.4.24.11 from EC), is another member of this group, it is variously known as common acute lymphoblastic leukemia antigen (CALLA), enkephalinase (gp100) and neutral endopeptidase metalloendopeptidase (NEP). It is a plasma membrane-bound mammalian enzyme that is able to digest biologically-active peptides, including enkephalins []. The zinc ligands of neprilysin are known and are analogous to those in thermolysin, a related peptidase [, ]. Neprilysins, like thermolysin, are inhibited by phosphoramidon, which appears to selectively inhibit this family in mammals. The enzymes are all oligopeptidases, digesting oligo- and polypeptides, but not proteins []. Neprilysin consists of a short cytoplasmic domain, a membrane-spanning region and a large extracellular domain. The cytoplasmic domain contains a conformationally-restrained octapeptide, which is thought to act as a stop transfer sequence that prevents proteolysis and secretion [, ].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2QPJ_A 1R1I_A 1R1J_A 1Y8J_A 1R1H_A 1DMT_A 2YB9_A 3DWB_A 3ZUK_A.
Probab=23.48  E-value=58  Score=28.95  Aligned_cols=19  Identities=26%  Similarity=0.039  Sum_probs=13.8

Q ss_pred             hHHHHHHHHHHHHHHHHHH
Q 020057          290 GALVTALVIGVHELGHILA  308 (331)
Q Consensus       290 ~al~ll~ILgvHE~GHyla  308 (331)
                      +-+|.++.+.+|||+|-+-
T Consensus        31 ~~yg~lG~ilahel~hafd   49 (206)
T PF01431_consen   31 LNYGGLGFILAHELMHAFD   49 (206)
T ss_dssp             HHHHTHHHHHHHHHHHCTS
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            3346677777899999663


No 67 
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only]
Probab=23.16  E-value=1.3e+02  Score=36.14  Aligned_cols=18  Identities=28%  Similarity=0.390  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHHHHHHcCC
Q 020057          297 VIGVHELGHILAAKSTGV  314 (331)
Q Consensus       297 ILgvHE~GHylaArr~gV  314 (331)
                      |=|..|++|-+++|-|+|
T Consensus       813 iEgsqeyn~klV~RLHkV  830 (1958)
T KOG0391|consen  813 IEGSQEYNHKLVIRLHKV  830 (1958)
T ss_pred             cccchhhchHHHHHHHHH
Confidence            556788999999999876


No 68 
>PF13492 GAF_3:  GAF domain; PDB: 3EEA_A 4DMZ_A 4DN0_A 1VHM_A.
Probab=23.07  E-value=1.7e+02  Score=22.40  Aligned_cols=28  Identities=29%  Similarity=0.462  Sum_probs=22.5

Q ss_pred             hHHHHHHHHHHHHHHhcC-CceEEEEEec
Q 020057          195 QAAKTYEKISTRMKNKFG-DQYKLFLLVN  222 (331)
Q Consensus       195 ~pEevy~kL~~kLee~fG-DrY~LfLvee  222 (331)
                      +++++++++.+.+.+.+| ++.-++++++
T Consensus         1 dl~~l~~~i~~~l~~~~~~~~~~l~~~d~   29 (129)
T PF13492_consen    1 DLDELLERILELLRELLGADRAALFLLDE   29 (129)
T ss_dssp             -HHHHHHHHHHHHHHHST-SEEEEEEEET
T ss_pred             CHHHHHHHHHHHHHHHhCCCEEEEEEEEC
Confidence            578999999999999999 5666676654


No 69 
>PF11667 DUF3267:  Protein of unknown function (DUF3267);  InterPro: IPR021683  This family of proteins has no known function. 
Probab=23.01  E-value=27  Score=28.68  Aligned_cols=21  Identities=38%  Similarity=0.350  Sum_probs=17.0

Q ss_pred             HHHHHHHHHHHHHHHHHcCCc
Q 020057          295 ALVIGVHELGHILAAKSTGVE  315 (331)
Q Consensus       295 l~ILgvHE~GHylaArr~gVk  315 (331)
                      +.++.+||+-|.+..+.++-+
T Consensus         4 ~~~~~~HEliH~l~~~~~~~~   24 (111)
T PF11667_consen    4 IVLIPLHELIHGLFFKLFGKK   24 (111)
T ss_pred             EeeHHHHHHHHHHHHHHhCCC
Confidence            345579999999999988773


No 70 
>PF05265 DUF723:  Protein of unknown function (DUF723);  InterPro: IPR007929 This family contains several uncharacterised proteins from Neisseria meningitidis. These proteins may have a role in DNA binding.
Probab=22.99  E-value=1.6e+02  Score=23.13  Aligned_cols=36  Identities=28%  Similarity=0.524  Sum_probs=27.2

Q ss_pred             HHHHHHHHHHHhcCCceEEEEEecCCCCCceEEEecCCC
Q 020057          199 TYEKISTRMKNKFGDQYKLFLLVNPEDDKPVAVVVPRKT  237 (331)
Q Consensus       199 vy~kL~~kLee~fGDrY~LfLvee~edgKPV~vVlP~~~  237 (331)
                      .++....+++++||+ |.|+  +-.....|+.|.-|.--
T Consensus         4 t~~~~~~r~~e~Fp~-~slv--ef~g~~~PvtI~CP~HG   39 (60)
T PF05265_consen    4 TFESAASRFEEKFPH-YSLV--EFSGVATPVTIRCPKHG   39 (60)
T ss_pred             eHHHHHHHHHHHCCC-ceEE--EEeCCCCceEEECCCCC
Confidence            366778899999999 7744  43345789999988774


No 71 
>PF12388 Peptidase_M57:  Dual-action HEIGH metallo-peptidase;  InterPro: IPR024653 This entry represents the metallopeptidases M10, M27 and M57. The catalytic triad for proteases in this entry is HE-H-H, which in many members is in the sequence motif HEIGH [].
Probab=22.49  E-value=50  Score=31.35  Aligned_cols=22  Identities=18%  Similarity=0.250  Sum_probs=15.1

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHH
Q 020057          289 PGALVTALVIGVHELGHILAAK  310 (331)
Q Consensus       289 P~al~ll~ILgvHE~GHylaAr  310 (331)
                      +++.-...-..+|||||-+==|
T Consensus       127 ~~~~~~~~hvi~HEiGH~IGfR  148 (211)
T PF12388_consen  127 NYSVNVIEHVITHEIGHCIGFR  148 (211)
T ss_pred             CCchhHHHHHHHHHhhhhcccc
Confidence            3455555556699999987544


No 72 
>PF04155 Ground-like:  Ground-like domain;  InterPro: IPR007284  This group of proteins contain one or more copies of the ground-like domain, which are specific to Caenorhabditis elegans and Caenorhabditis briggsae. It has been proposed that the ground-like domain containing proteins may bind and modulate the activity of Patched-like membrane molecules, reminiscent of the modulating activities of neuropeptides []. 
Probab=22.45  E-value=58  Score=25.30  Aligned_cols=26  Identities=12%  Similarity=0.323  Sum_probs=23.5

Q ss_pred             ChHHHHHHHHHHHHHHhcCCceEEEE
Q 020057          194 GQAAKTYEKISTRMKNKFGDQYKLFL  219 (331)
Q Consensus       194 g~pEevy~kL~~kLee~fGDrY~LfL  219 (331)
                      .++..+-+.|++.++++||.+|.++.
T Consensus        22 ~~~~~s~~~Iq~~~e~~f~~~f~vIc   47 (76)
T PF04155_consen   22 CNLSISKRAIQKAAEKRFGGSFEVIC   47 (76)
T ss_pred             CCHHHHHHHHHHHHHHHhCCCEEEEE
Confidence            78899999999999999999999654


No 73 
>PF01454 MAGE:  MAGE family;  InterPro: IPR002190 The first mammalian members of the MAGE (melanoma-associated antigen) gene family were originally described as completely silent in normal adult tissues, with the exception of male germ cells and, for some of them, placenta. By contrast, these genes were expressed in various kinds of tumors. However, other members of the family were recently found to be expressed in normal cells, indicating that the family is larger and more disparate than initially expected. MAGE-like genes have also been identified in non-mammalian species, including Drosophila melanogaster (Fruit fly) and Danio rerio (Zebrafish). Although no MAGE homologous sequences have been identified in Caenorhabditis elegans, Saccharomyces cerevisiae (Baker's yeast) or Schizosaccharomyces pombe (Fission yeast), MAGE sequences have been found in several vegetal species, including Arabidopsis thaliana (Mouse-ear cress) [].  The only region of homology shared by all of the members of the family is a stretch of about 200 amino acids which has been named the MAGE conserved domain. The MAGE conserved domain is usually located close to the C-terminal, although it can also be found in a more central position in some proteins. The MAGE conserved domain is generally present as a single copy but it is duplicated in some proteins. It has been proposed that the MAGE conserved domain of MAGE-D proteins might interact with p75 neurotrophin or related receptors [].; PDB: 3NW0_B 2WA0_A 1I4F_C.
Probab=22.28  E-value=3.7e+02  Score=23.87  Aligned_cols=26  Identities=19%  Similarity=0.525  Sum_probs=21.0

Q ss_pred             CChHHHHHHHHHHHHHHhcCCceEEEEE
Q 020057          193 RGQAAKTYEKISTRMKNKFGDQYKLFLL  220 (331)
Q Consensus       193 Rg~pEevy~kL~~kLee~fGDrY~LfLv  220 (331)
                      +..-.++|++.++.|++.||  |.|.-+
T Consensus        29 ~~~f~~v~~~a~~~L~~vFG--~eL~ev   54 (195)
T PF01454_consen   29 RRKFPEVFERANEILEDVFG--FELVEV   54 (195)
T ss_dssp             GGGHHHHHHHHHHHHHHHH---EEEEES
T ss_pred             HHHhHHHHHHHHHHHHHHhc--eEEEEe
Confidence            55679999999999999999  985543


No 74 
>PRK13267 archaemetzincin-like protein; Reviewed
Probab=22.15  E-value=45  Score=30.48  Aligned_cols=11  Identities=55%  Similarity=0.730  Sum_probs=8.8

Q ss_pred             HHHHHHHHHHH
Q 020057          298 IGVHELGHILA  308 (331)
Q Consensus       298 LgvHE~GHyla  308 (331)
                      .++||+||-+-
T Consensus       128 ~~~HElGH~lG  138 (179)
T PRK13267        128 EVTHELGHTLG  138 (179)
T ss_pred             HHHHHHHHHcC
Confidence            36999999863


No 75 
>PF09471 Peptidase_M64:  IgA Peptidase M64;  InterPro: IPR019026 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases [].  This is a family of highly selective metallo-endopeptidases belonging to the MEROPS peptidase family M64 (IgA peptidase, clan MA). The primary structure of the Clostridium ramosum IgA peptidase shows no significant overall similarity to any other known metallo-endopeptidase []. ; PDB: 3P1V_A 4DF9_D.
Probab=22.07  E-value=45  Score=32.24  Aligned_cols=12  Identities=42%  Similarity=0.739  Sum_probs=9.2

Q ss_pred             HHHHHHHHHHHH
Q 020057          297 VIGVHELGHILA  308 (331)
Q Consensus       297 ILgvHE~GHyla  308 (331)
                      -+.+||+||-++
T Consensus       218 ~v~vHE~GHsf~  229 (264)
T PF09471_consen  218 QVVVHEFGHSFG  229 (264)
T ss_dssp             HHHHHHHHHHTT
T ss_pred             ceeeeecccccc
Confidence            456999999654


No 76 
>KOG2236 consensus Uncharacterized conserved protein [Function unknown]
Probab=21.99  E-value=1.2e+02  Score=32.31  Aligned_cols=22  Identities=27%  Similarity=0.314  Sum_probs=14.5

Q ss_pred             CCCCCCCCCCcccccCCCHhHH
Q 020057          140 SPLPGVKPQQLDEYIRIPKETI  161 (331)
Q Consensus       140 ~p~~g~~~~~~~~~~~ip~EdL  161 (331)
                      .|++.-....+++-.++++++|
T Consensus       179 ~p~ktr~e~ll~elPpv~~~~i  200 (483)
T KOG2236|consen  179 KPQKTRNEHLLDELPPVEPEEI  200 (483)
T ss_pred             cCCCCCCchhhhcCCCCCccce
Confidence            5666666666677777777764


No 77 
>PF08219 TOM13:  Outer membrane protein TOM13;  InterPro: IPR013262 The TOM13 family of proteins are mitochondrial outer membrane proteins that mediate the assembly of beta-barrel proteins [].; GO: 0005741 mitochondrial outer membrane
Probab=21.58  E-value=73  Score=26.11  Aligned_cols=20  Identities=20%  Similarity=0.183  Sum_probs=14.3

Q ss_pred             HHHHHHHHHHHHHHHcCCcccc
Q 020057          297 VIGVHELGHILAAKSTGVELGV  318 (331)
Q Consensus       297 ILgvHE~GHylaArr~gVklSl  318 (331)
                      =|.+||++++|  ...|-|+-+
T Consensus        54 El~AhE~~fr~--gW~g~ki~P   73 (77)
T PF08219_consen   54 ELFAHEIAFRL--GWSGTKIFP   73 (77)
T ss_pred             HHHHHHHHHHh--ccCcceecC
Confidence            56699999988  446666544


No 78 
>PRK06842 fumarate hydratase; Provisional
Probab=21.42  E-value=95  Score=29.02  Aligned_cols=61  Identities=16%  Similarity=0.287  Sum_probs=45.4

Q ss_pred             cCCCHhHHHHHhhcccccceEEEEeeeeeCCeEEEEcccCChHHHHHHHHHHHHHHhcCCceEEEEEecCCCCCceEEEe
Q 020057          154 IRIPKETIDILKDQVFGFDTFFVTNQEPYEGGVLFKGNLRGQAAKTYEKISTRMKNKFGDQYKLFLLVNPEDDKPVAVVV  233 (331)
Q Consensus       154 ~~ip~EdLk~IK~~~FG~dTFfvT~~e~~~qGVIfRGNLRg~pEevy~kL~~kLee~fGDrY~LfLvee~edgKPV~vVl  233 (331)
                      .|+.+||++.||-                ++-|...|.+-.-++.+|++|.+.+++  |...- |   + ..++.++..-
T Consensus         7 tPl~~e~i~~L~v----------------GD~V~LsG~i~taRDaAHkrl~e~l~~--G~~lP-~---d-l~g~~Iy~~G   63 (185)
T PRK06842          7 TPLTEEKVKDLKA----------------GDSVLISGYIYTARDAAHKRLIELLDK--GEELP-I---D-IKDQIIYYVG   63 (185)
T ss_pred             CCCCHHHHhhCCC----------------CCEEEEeEEEEEEeHHHHHHHHHHHhc--CCCCC-c---C-cCCCEEEEec
Confidence            5789999999885                777888888888889999999999877  43322 2   1 2466777777


Q ss_pred             cCCC
Q 020057          234 PRKT  237 (331)
Q Consensus       234 P~~~  237 (331)
                      |...
T Consensus        64 P~~~   67 (185)
T PRK06842         64 PSPA   67 (185)
T ss_pred             CCCC
Confidence            7664


No 79 
>PLN03199 delta6-acyl-lipid desaturase-like protein; Provisional
Probab=21.34  E-value=2e+02  Score=29.88  Aligned_cols=17  Identities=18%  Similarity=0.352  Sum_probs=13.7

Q ss_pred             hHHHHHHHHHHHHHHhcC
Q 020057          195 QAAKTYEKISTRMKNKFG  212 (331)
Q Consensus       195 ~pEevy~kL~~kLee~fG  212 (331)
                      +..+-|.+|++++++. |
T Consensus       109 ~~~~~y~~L~~~v~~~-g  125 (485)
T PLN03199        109 AFEKGYRDLRAKLIMM-G  125 (485)
T ss_pred             HHHHHHHHHHHHHHHc-C
Confidence            3467899999999986 7


No 80 
>PF07998 Peptidase_M54:  Peptidase family M54;  InterPro: IPR012962 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This entry represents zinc-dependent peptidases belonging to the MEROPS peptidase family M54, more commonly known as the archaemetzincins. The family has a wide taxonomic distribution, being found in archaea, bacteria and eukaryotes. Two human homologues have been characterised []. ; GO: 0008237 metallopeptidase activity, 0008270 zinc ion binding; PDB: 3LMC_A 2XHQ_A 2X7M_A.
Probab=21.09  E-value=44  Score=31.19  Aligned_cols=31  Identities=16%  Similarity=0.267  Sum_probs=17.3

Q ss_pred             eEEEEcccC--ChHHHHHHHHHHHHHHhcCCceE
Q 020057          185 GVLFKGNLR--GQAAKTYEKISTRMKNKFGDQYK  216 (331)
Q Consensus       185 GVIfRGNLR--g~pEevy~kL~~kLee~fGDrY~  216 (331)
                      ++.+.||-.  ---.++|+++.+.+++. |-...
T Consensus         5 ~~~~~g~~~~~~~~~~v~d~v~~~~~~~-~l~v~   37 (194)
T PF07998_consen    5 AFVYIGNTEFEWLFFEVYDRVNRFLSEF-GLPVK   37 (194)
T ss_dssp             EEESSS--T---THHHHHHHHHHHHHHH-H-S-E
T ss_pred             EEEEECCchhHHHHHHHHHHHHHHHHHc-CCceE
Confidence            345566633  23467888888888886 54454


No 81 
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=20.99  E-value=57  Score=28.12  Aligned_cols=11  Identities=36%  Similarity=0.362  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHH
Q 020057          300 VHELGHILAAK  310 (331)
Q Consensus       300 vHE~GHylaAr  310 (331)
                      .|||.|+++-.
T Consensus        64 ~HEm~H~~~~~   74 (146)
T smart00731       64 LHELCHAALYL   74 (146)
T ss_pred             HHHHHHHHHHH
Confidence            79999999874


No 82 
>PF12315 DUF3633:  Protein of unknown function (DUF3633);  InterPro: IPR022087  This domain family is found in bacteria and eukaryotes, and is approximately 210 amino acids in length. The family is found in association with PF00412 from PFAM. 
Probab=20.70  E-value=58  Score=31.10  Aligned_cols=27  Identities=33%  Similarity=0.551  Sum_probs=17.2

Q ss_pred             hhhchhhHHHHHHHHHHHHHHHHHHHHHcC
Q 020057          284 LTNGLPGALVTALVIGVHELGHILAAKSTG  313 (331)
Q Consensus       284 l~~gLP~al~ll~ILgvHE~GHylaArr~g  313 (331)
                      ++.|||--+. .+|| +||++|-|. |-.|
T Consensus        84 vl~GLPrll~-gsiL-AHE~mHa~L-rl~g  110 (212)
T PF12315_consen   84 VLYGLPRLLT-GSIL-AHELMHAWL-RLNG  110 (212)
T ss_pred             EECCCCHHHH-hhHH-HHHHHHHHh-cccC
Confidence            4567774332 2344 999999998 3344


No 83 
>KOG2987 consensus Fatty acid desaturase [Lipid transport and metabolism]
Probab=20.54  E-value=2.7e+02  Score=28.02  Aligned_cols=13  Identities=46%  Similarity=0.841  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHHHH
Q 020057          296 LVIGVHELGHILA  308 (331)
Q Consensus       296 ~ILgvHE~GHyla  308 (331)
                      ..|++||+.|-.+
T Consensus        84 l~LAIHeiSHN~a   96 (324)
T KOG2987|consen   84 LTLAIHEISHNLA   96 (324)
T ss_pred             HHHHHHHhhhhhh
Confidence            4788999999665


No 84 
>TIGR01364 serC_1 phosphoserine aminotransferase. This model represents the common form of the phosphoserine aminotransferase SerC. The phosphoserine aminotransferase of the archaeon Methanosarcina barkeri and putative phosphoserine aminotransferase of Mycobacterium tuberculosis are represented by separate models. All are members of the class V aminotransferases (pfam00266).
Probab=20.53  E-value=1.4e+02  Score=29.16  Aligned_cols=60  Identities=10%  Similarity=0.208  Sum_probs=41.6

Q ss_pred             CCCHhHHHHHhhcccccceEEEEeeeeeCCeEEEEcccCChHHHHHHHHHHHHHHhcC--CceEEEEEec
Q 020057          155 RIPKETIDILKDQVFGFDTFFVTNQEPYEGGVLFKGNLRGQAAKTYEKISTRMKNKFG--DQYKLFLLVN  222 (331)
Q Consensus       155 ~ip~EdLk~IK~~~FG~dTFfvT~~e~~~qGVIfRGNLRg~pEevy~kL~~kLee~fG--DrY~LfLvee  222 (331)
                      .+|.+.++++++       ||.+.- .-.-|+.-.+.--.+-.++|+.++++|++.||  ++|.++++..
T Consensus         2 ~~p~~v~~~~~~-------~~~~~~-~~~~~~~~~~hr~~~f~~~~~~~~~~l~~l~~~~~~~~v~~~~g   63 (349)
T TIGR01364         2 ALPEEVLEQAQK-------ELLNFN-GTGMSVMEISHRSKEFEAVANEAESDLRELLNIPDNYEVLFLQG   63 (349)
T ss_pred             CCCHHHHHHHHH-------HHhCcc-CCCccccccCCCchHHHHHHHHHHHHHHHHhCCCCCceEEEEcC
Confidence            468888999997       333221 22334555555444556999999999999999  5788887765


No 85 
>KOG3320 consensus 40S ribosomal protein S7 [Translation, ribosomal structure and biogenesis]
Probab=20.24  E-value=1.5e+02  Score=27.89  Aligned_cols=27  Identities=15%  Similarity=0.304  Sum_probs=19.8

Q ss_pred             HHHHHHHHHHHHHHhcCCceEEEEEec
Q 020057          196 AAKTYEKISTRMKNKFGDQYKLFLLVN  222 (331)
Q Consensus       196 pEevy~kL~~kLee~fGDrY~LfLvee  222 (331)
                      =.++|.+|-..|+++|+|||.+|+-+.
T Consensus        73 fqki~~~LvreleKKF~gk~Vifia~R   99 (192)
T KOG3320|consen   73 FQKIQVRLVRELEKKFSGKHVIFIAQR   99 (192)
T ss_pred             HHHHHHHHHHHHHHhcCCceEEEEEee
Confidence            345555555689999999999887554


No 86 
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]
Probab=20.16  E-value=62  Score=34.31  Aligned_cols=7  Identities=57%  Similarity=1.341  Sum_probs=6.4

Q ss_pred             HHHHHHH
Q 020057          300 VHELGHI  306 (331)
Q Consensus       300 vHE~GHy  306 (331)
                      +||+||.
T Consensus       135 AHEigHv  141 (484)
T COG4783         135 AHEIGHV  141 (484)
T ss_pred             HHHHHHH
Confidence            8999996


Done!