Query         020057
Match_columns 331
No_of_seqs    180 out of 285
Neff          3.8 
Searched_HMMs 29240
Date          Mon Mar 25 11:07:16 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/020057.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/020057hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3b4r_A Putative zinc metallopr  97.4 9.4E-05 3.2E-09   67.1   3.5   36  289-324    42-77  (224)
  2 2cki_A Ulilysin; metalloprotea  60.6     2.4 8.3E-05   39.2   0.9   12  297-308   164-175 (262)
  3 3cqb_A Probable protease HTPX   52.6     6.2 0.00021   31.2   1.9    9  299-307    87-95  (107)
  4 3m92_A Protein YCIN; DUF2498,   48.6      30   0.001   28.5   5.4   67  150-217    24-103 (107)
  5 2w15_A Zinc metalloproteinase   47.0     7.2 0.00025   33.6   1.6   17  295-311   136-152 (202)
  6 1bud_A Protein (acutolysin A);  40.0      11 0.00039   32.2   1.8   17  295-311   133-149 (197)
  7 1atl_A Atrolysin C; metalloend  39.9      11 0.00039   32.4   1.8   16  296-311   137-152 (202)
  8 1qua_A Acutolysin-C, hemorrhag  39.0      11 0.00039   32.2   1.6   17  295-311   135-151 (197)
  9 2ddf_A ADAM 17; hydrolase; HET  38.6      12 0.00042   33.2   1.8   17  295-311   182-198 (257)
 10 1kuf_A Atrolysin E, metallopro  38.0      13 0.00044   32.2   1.8   17  295-311   138-154 (203)
 11 1yp1_A FII; FII hydrolase; 1.9  37.4      12 0.00043   32.2   1.6   16  296-311   136-151 (202)
 12 3b8z_A Protein adamts-5; alpha  37.2      13 0.00043   32.4   1.6   16  296-311   142-157 (217)
 13 4aw6_A CAAX prenyl protease 1   36.2      14 0.00048   37.0   2.0   13  294-307   329-341 (482)
 14 2xs4_A Karilysin protease; hyd  35.4      17 0.00059   30.4   2.1   17  298-314   118-134 (167)
 15 2v4b_A Adamts-1; zymogen, prot  35.2      14 0.00047   33.8   1.6   17  295-311   143-159 (300)
 16 2ovx_A Matrix metalloproteinas  34.5      15 0.00051   30.8   1.6   16  298-313   114-129 (159)
 17 1z8u_A Alpha-hemoglobin stabil  34.1     1.8 6.1E-05   35.4  -4.0   60  148-219    24-89  (102)
 18 2rjp_A Adamts-4; metalloprotea  34.0      15  0.0005   33.9   1.6   17  295-311   143-159 (316)
 19 2rjq_A Adamts-5; metalloprotea  33.0      15 0.00053   34.6   1.6   17  295-311   143-159 (378)
 20 2ejq_A Hypothetical protein TT  32.7      23 0.00078   29.7   2.4   19  295-313    89-109 (130)
 21 4dd8_A Disintegrin and metallo  32.4      21 0.00073   30.9   2.3   16  296-311   134-149 (208)
 22 2jsd_A Matrix metalloproteinas  32.2      21 0.00072   29.4   2.1   15  299-313   112-126 (160)
 23 2ero_A VAP-1, vascular apoptos  31.8      17 0.00059   35.3   1.8   18  294-311   145-162 (427)
 24 1hy7_A Stromelysin-1, MMP-3; m  31.1      22 0.00076   30.0   2.1   16  299-314   117-132 (173)
 25 2e3x_A Coagulation factor X-ac  30.7      20 0.00067   35.0   1.9   17  295-311   139-155 (427)
 26 1r55_A ADAM 33; metalloproteas  30.5      19 0.00064   31.4   1.6   16  296-311   137-152 (214)
 27 2dw0_A Catrocollastatin; apopt  30.3      19 0.00066   35.0   1.8   17  295-311   137-153 (419)
 28 2i47_A ADAM 17; TACE-inhibitor  30.1      20 0.00068   32.5   1.8   17  295-311   188-204 (288)
 29 3c37_A Peptidase, M48 family;   29.8      22 0.00075   31.9   1.9   13  294-307   100-112 (253)
 30 1c7k_A NCNP, zinc endoprotease  28.9      26 0.00088   29.6   2.1   11  298-308    80-90  (132)
 31 1i76_A MMP-8;, neutrophil coll  27.4      28 0.00096   29.2   2.1   16  298-313   115-130 (163)
 32 1cge_A Fibroblast collagenase;  27.3      23  0.0008   29.8   1.6   13  299-311   115-127 (168)
 33 1hv5_A Stromelysin 3; inhibiti  27.0      24 0.00082   29.6   1.6   17  298-314   116-132 (165)
 34 2isb_A Fumarase, FUM-1; NP_069  27.0      46  0.0016   30.0   3.5   60  153-235    20-79  (192)
 35 4axq_A Archaemetzincin; metall  26.5      24 0.00084   30.4   1.6   18  195-212    13-30  (163)
 36 1rm8_A MMP-16, matrix metallop  26.3      30   0.001   29.0   2.1   16  298-313   120-135 (169)
 37 2y6d_A Matrilysin; hydrolase;   25.0      33  0.0011   29.2   2.1   16  297-312   117-132 (174)
 38 3k7n_A K-like; SVMP, hydrolase  24.6      31  0.0011   33.4   2.1   16  295-310   139-154 (397)
 39 1y93_A Macrophage metalloelast  23.5      30   0.001   29.0   1.6   14  298-311   111-124 (159)
 40 3k7l_A Atragin; SVMP, metallop  23.2      34  0.0012   33.4   2.1   16  295-310   144-159 (422)
 41 3ayu_A 72 kDa type IV collagen  22.8      32  0.0011   29.1   1.6   17  298-314   117-133 (167)
 42 3dte_A IRRE protein; radiotole  21.8      33  0.0011   32.4   1.6   13  298-310    99-111 (301)
 43 830c_A MMP-13, MMP-13; matrix   20.4      38  0.0013   28.9   1.6   18  298-315   116-133 (168)
 44 1slm_A Stromelysin-1; hydrolas  20.4      37  0.0013   30.9   1.6   17  298-314   198-214 (255)

No 1  
>3b4r_A Putative zinc metalloprotease MJ0392; intramembrane protease, CBS domain, hydrolase, metal-binding, transmembrane; 3.30A {Methanocaldococcus jannaschii}
Probab=97.36  E-value=9.4e-05  Score=67.12  Aligned_cols=36  Identities=28%  Similarity=0.387  Sum_probs=33.1

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHcCCccccceeccc
Q 020057          289 PGALVTALVIGVHELGHILAAKSTGVELGVPYFVPS  324 (331)
Q Consensus       289 P~al~ll~ILgvHE~GHylaArr~gVklSlPyFIP~  324 (331)
                      .++++++.++.+||+||+++||++|+++.-..++|+
T Consensus        42 ~~~l~l~~~v~~HElgH~~~A~~~G~~~~~i~l~p~   77 (224)
T 3b4r_A           42 VLFILLFVSVVLHELGHSYVAKKYGVKIEKILLLPI   77 (224)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEECSS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHcCCccccEEEEEe
Confidence            778888888999999999999999999999999885


No 2  
>2cki_A Ulilysin; metalloprotease, hydrolase; HET: ARG; 1.7A {Methanosarcina acetivorans} PDB: 2j83_A* 3lum_A* 3lun_A*
Probab=60.57  E-value=2.4  Score=39.19  Aligned_cols=12  Identities=42%  Similarity=0.689  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHHH
Q 020057          297 VIGVHELGHILA  308 (331)
Q Consensus       297 ILgvHE~GHyla  308 (331)
                      -.++||+|||+=
T Consensus       164 ~TltHEvGH~LG  175 (262)
T 2cki_A          164 RTATHEIGHWLN  175 (262)
T ss_dssp             HHHHHHHHHHTT
T ss_pred             chhhhhhhhhhc
Confidence            556999999973


No 3  
>3cqb_A Probable protease HTPX homolog; heat shock protein HTPX domain, PSI-2, protein structure INI structural genomics; HET: MSE; 1.86A {Vibrio parahaemolyticus rimd 2210633}
Probab=52.56  E-value=6.2  Score=31.24  Aligned_cols=9  Identities=44%  Similarity=0.604  Sum_probs=7.6

Q ss_pred             HHHHHHHHH
Q 020057          299 GVHELGHIL  307 (331)
Q Consensus       299 gvHE~GHyl  307 (331)
                      .+||+||+.
T Consensus        87 laHElgH~~   95 (107)
T 3cqb_A           87 LAHEVSHIA   95 (107)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHH
Confidence            389999985


No 4  
>3m92_A Protein YCIN; DUF2498, structural genomics, PSI-2, protein structure initi midwest center for structural genomics, MCSG, unknown funct; HET: MSE; 2.05A {Shigella flexneri 2A}
Probab=48.63  E-value=30  Score=28.55  Aligned_cols=67  Identities=16%  Similarity=0.337  Sum_probs=45.4

Q ss_pred             cccccCCCHhHH-----HHHhhcccccceEEEEeeeeeCCeEEEEccc--CC------hHHHHHHHHHHHHHHhcCCceE
Q 020057          150 LDEYIRIPKETI-----DILKDQVFGFDTFFVTNQEPYEGGVLFKGNL--RG------QAAKTYEKISTRMKNKFGDQYK  216 (331)
Q Consensus       150 ~~~~~~ip~EdL-----k~IK~~~FG~dTFfvT~~e~~~qGVIfRGNL--Rg------~pEevy~kL~~kLee~fGDrY~  216 (331)
                      ..+..+|++++|     ++||+.===+....+|+++..++..+|||+.  ..      +...||+ +-+.|+-.+..+|.
T Consensus        24 ~~~~~~I~r~~LL~~AN~iI~eHeDyi~GM~A~~Veqk~~VLVFkGeyFLDe~GLPT~KTTAVFN-MFK~LAh~LS~ky~  102 (107)
T 3m92_A           24 NKETQPIDRETLLKEANKIIREHEDTLAGIEATGVTQRNGVLVFTGDYFLDEQGLPTAKSTAVFN-MFKHLAHVLSEKYH  102 (107)
T ss_dssp             -CCCEEECHHHHHHHHHHHHHHHHHHHTTCCEEEEEESSSCEEEEECCCCCTTSCCCHHHHHHHH-HHHHHHHHHTTTEE
T ss_pred             cCCCCccCHHHHHHHHHHHHHHhHHHhccccccceeeeCCEEEEecceeecCCCCCCcccHHHHH-HHHHHHHHhChhee
Confidence            346678899887     3454321123346799999999999999983  22      2345554 56777778888898


Q ss_pred             E
Q 020057          217 L  217 (331)
Q Consensus       217 L  217 (331)
                      |
T Consensus       103 L  103 (107)
T 3m92_A          103 L  103 (107)
T ss_dssp             E
T ss_pred             c
Confidence            3


No 5  
>2w15_A Zinc metalloproteinase BAP1; hydrolase inhibitor complex, metal-binding, zinc-depending, metalloprotease, metalloproteinase/inhibitor complex; HET: WR2; 1.05A {Bothrops asper} PDB: 2w12_A* 2w13_A* 2w14_A* 1nd1_A 3gbo_A
Probab=47.02  E-value=7.2  Score=33.64  Aligned_cols=17  Identities=41%  Similarity=0.507  Sum_probs=12.8

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 020057          295 ALVIGVHELGHILAAKS  311 (331)
Q Consensus       295 l~ILgvHE~GHylaArr  311 (331)
                      +++..+|||||-+=+..
T Consensus       136 ~a~~~AHElGH~lG~~H  152 (202)
T 2w15_A          136 VAVTMAHELGHNLGIHH  152 (202)
T ss_dssp             HHHHHHHHHHHHTTCCC
T ss_pred             HHHHHHHHHhhhcCCcc
Confidence            35667999999886653


No 6  
>1bud_A Protein (acutolysin A); metalloproteinase, snake venom, MMP, toxin; 1.90A {Deinagkistrodon acutus} SCOP: d.92.1.9 PDB: 1bsw_A
Probab=40.04  E-value=11  Score=32.23  Aligned_cols=17  Identities=24%  Similarity=0.348  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 020057          295 ALVIGVHELGHILAAKS  311 (331)
Q Consensus       295 l~ILgvHE~GHylaArr  311 (331)
                      +++..+|||||-+=+..
T Consensus       133 ~a~~~AHElGH~lG~~H  149 (197)
T 1bud_A          133 VAITLAHEMAHNLGVSH  149 (197)
T ss_dssp             HHHHHHHHHHHHTTCCC
T ss_pred             HHHHHHHHHhhhcCCcc
Confidence            35667999999886653


No 7  
>1atl_A Atrolysin C; metalloendopeptidase, hydrolase-hydrolase inhibitor complex; HET: 0QI; 1.80A {Crotalus atrox} SCOP: d.92.1.9 PDB: 1htd_A 1dth_A* 3aig_A* 2aig_P* 4aig_A* 1iag_A
Probab=39.92  E-value=11  Score=32.42  Aligned_cols=16  Identities=44%  Similarity=0.484  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHHHHHH
Q 020057          296 LVIGVHELGHILAAKS  311 (331)
Q Consensus       296 ~ILgvHE~GHylaArr  311 (331)
                      ++..+|||||-+=+..
T Consensus       137 a~~~AHElGHnlG~~H  152 (202)
T 1atl_A          137 GVTMAHELGHNLGMEH  152 (202)
T ss_dssp             HHHHHHHHHHHTTCCC
T ss_pred             EEEehhhhccccCcee
Confidence            4667999999876553


No 8  
>1qua_A Acutolysin-C, hemorrhagin III; metalloprotease, hemorrhagic toxin, snake venom proteinase; 2.20A {Deinagkistrodon acutus} SCOP: d.92.1.9
Probab=38.98  E-value=11  Score=32.23  Aligned_cols=17  Identities=41%  Similarity=0.497  Sum_probs=12.5

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 020057          295 ALVIGVHELGHILAAKS  311 (331)
Q Consensus       295 l~ILgvHE~GHylaArr  311 (331)
                      .++..+|||||-+=+..
T Consensus       135 ~a~~~AHElGH~lG~~H  151 (197)
T 1qua_A          135 MAVTMAHELGHNLGMNH  151 (197)
T ss_dssp             HHHHHHHHHHHHTTCCC
T ss_pred             HHHHHHHHHHHhcCCCC
Confidence            35667999999876553


No 9  
>2ddf_A ADAM 17; hydrolase; HET: INN CIT; 1.70A {Homo sapiens} PDB: 2fv5_A* 3l0v_A* 3kme_A* 3l0t_A* 3kmc_A* 3le9_A* 3lea_A* 3lgp_A* 3o64_A* 3ewj_A* 3edz_A* 3e8r_A* 2fv9_A* 1zxc_A* 2oi0_A* 3b92_A* 2a8h_A* 1bkc_A* 3cki_A 1bkc_I* ...
Probab=38.56  E-value=12  Score=33.25  Aligned_cols=17  Identities=41%  Similarity=0.618  Sum_probs=13.1

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 020057          295 ALVIGVHELGHILAAKS  311 (331)
Q Consensus       295 l~ILgvHE~GHylaArr  311 (331)
                      .++..+|||||-|=+..
T Consensus       182 ~a~~~AHElGHnlG~~H  198 (257)
T 2ddf_A          182 ADLVTTHELGHNFGAEH  198 (257)
T ss_dssp             HHHHHHHHHHHHTTCCC
T ss_pred             eeeeeeeehhhhcCccc
Confidence            45667999999886654


No 10 
>1kuf_A Atrolysin E, metalloproteinase; alpha/beta protein, hydrolase; 1.35A {Protobothrops mucrosquamatus} SCOP: d.92.1.9 PDB: 1kui_A 1kuk_A 1kug_A 1wni_A
Probab=37.98  E-value=13  Score=32.21  Aligned_cols=17  Identities=41%  Similarity=0.518  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 020057          295 ALVIGVHELGHILAAKS  311 (331)
Q Consensus       295 l~ILgvHE~GHylaArr  311 (331)
                      +++..+|||||-+=+..
T Consensus       138 ~a~~~AHElGH~lG~~H  154 (203)
T 1kuf_A          138 VAVTMTHELGHNLGMEH  154 (203)
T ss_dssp             HHHHHHHHHHHHTTCCC
T ss_pred             hHHHHHHHhhhhcCCCC
Confidence            45667999999876553


No 11 
>1yp1_A FII; FII hydrolase; 1.90A {Deinagkistrodon acutus}
Probab=37.39  E-value=12  Score=32.18  Aligned_cols=16  Identities=44%  Similarity=0.559  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHHHH
Q 020057          296 LVIGVHELGHILAAKS  311 (331)
Q Consensus       296 ~ILgvHE~GHylaArr  311 (331)
                      ++..+|||||-+=+..
T Consensus       136 a~~~AHElGH~lG~~H  151 (202)
T 1yp1_A          136 AVVMAHELGHNLGMLH  151 (202)
T ss_dssp             HHHHHHHHHHHTTCCC
T ss_pred             HHHHHHHHHHhcCCCC
Confidence            5667999999876553


No 12 
>3b8z_A Protein adamts-5; alpha/beta, hydrolase; HET: 294; 1.40A {Homo sapiens} PDB: 3hyg_A* 3hy9_A* 3hy7_A* 3ljt_A*
Probab=37.20  E-value=13  Score=32.38  Aligned_cols=16  Identities=31%  Similarity=0.544  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHHHHHHH
Q 020057          296 LVIGVHELGHILAAKS  311 (331)
Q Consensus       296 ~ILgvHE~GHylaArr  311 (331)
                      ++..+|||||-+=+..
T Consensus       142 a~~~AHElGHnlG~~H  157 (217)
T 3b8z_A          142 AFTVAHEIGHLLGLSH  157 (217)
T ss_dssp             HHHHHHHHHHHTTCCC
T ss_pred             hhhhHhhhhhhcCCcC
Confidence            4567999999886543


No 13 
>4aw6_A CAAX prenyl protease 1 homolog; hydrolase, M48 peptidase, integral membrane protein, prelami processing, ageing, progeria; HET: PC1; 3.40A {Homo sapiens} PDB: 2ypt_A
Probab=36.20  E-value=14  Score=37.05  Aligned_cols=13  Identities=46%  Similarity=0.585  Sum_probs=9.4

Q ss_pred             HHHHHHHHHHHHHH
Q 020057          294 TALVIGVHELGHIL  307 (331)
Q Consensus       294 ll~ILgvHE~GHyl  307 (331)
                      +.+|+ +||+||+-
T Consensus       329 l~aVl-aHElgH~~  341 (482)
T 4aw6_A          329 VLAVL-GHELGHWK  341 (482)
T ss_dssp             HHHHH-HHHHHHHH
T ss_pred             HHHHH-HHHHHHHH
Confidence            44455 89999973


No 14 
>2xs4_A Karilysin protease; hydrolase, bacterial MMP, virulence factor, metalloprotease, dependent, peptidase; 1.70A {Tannerella forsythia} PDB: 2xs3_A
Probab=35.41  E-value=17  Score=30.41  Aligned_cols=17  Identities=35%  Similarity=0.814  Sum_probs=11.8

Q ss_pred             HHHHHHHHHHHHHHcCC
Q 020057          298 IGVHELGHILAAKSTGV  314 (331)
Q Consensus       298 LgvHE~GHylaArr~gV  314 (331)
                      .++|||||-+=-..-..
T Consensus       118 v~~HEiGHaLGL~H~~~  134 (167)
T 2xs4_A          118 VAAHEIGHLLGIEHSNV  134 (167)
T ss_dssp             HHHHHHHHHHTBCCCSC
T ss_pred             hHHHHHHHhhcCCCCCC
Confidence            35899999986544343


No 15 
>2v4b_A Adamts-1; zymogen, protease, hydrolase, metalloprotease, heparin-binding, metalloproteinase, metzincin, glycoprotein metal-binding; 2.00A {Homo sapiens} PDB: 2jih_A 3q2g_A* 3q2h_A*
Probab=35.22  E-value=14  Score=33.81  Aligned_cols=17  Identities=35%  Similarity=0.573  Sum_probs=12.9

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 020057          295 ALVIGVHELGHILAAKS  311 (331)
Q Consensus       295 l~ILgvHE~GHylaArr  311 (331)
                      +++..+|||||-|=+..
T Consensus       143 ~a~t~AHElGHnlG~~H  159 (300)
T 2v4b_A          143 AAFTTAHELGHVFNMPH  159 (300)
T ss_dssp             HHHHHHHHHHHHTTCCC
T ss_pred             ceehhhhhhhhhcCCcC
Confidence            34667999999886654


No 16 
>2ovx_A Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) type IV collagenase) (92 kDa gelatinase)...; S1-prime pocket, hydrolase-hydrola inhibitor complex; HET: 4MR; 2.00A {Homo sapiens} SCOP: d.92.1.11 PDB: 2ovz_A* 2ow0_A* 2ow1_A* 2ow2_A* 1gkd_A* 1gkc_A*
Probab=34.51  E-value=15  Score=30.81  Aligned_cols=16  Identities=25%  Similarity=0.640  Sum_probs=11.2

Q ss_pred             HHHHHHHHHHHHHHcC
Q 020057          298 IGVHELGHILAAKSTG  313 (331)
Q Consensus       298 LgvHE~GHylaArr~g  313 (331)
                      .++|||||-+=-..-.
T Consensus       114 va~HEiGHaLGL~Hs~  129 (159)
T 2ovx_A          114 VAAHQFGHALGLDHSS  129 (159)
T ss_dssp             HHHHHHHHHTTCCCCS
T ss_pred             hhhhhhhhhhcCCCCC
Confidence            4589999987654433


No 17 
>1z8u_A Alpha-hemoglobin stabilizing protein; alpha haemoglobin, AHSP, oxidation, interaction, electron transport; HET: HEM; 2.40A {Homo sapiens} SCOP: a.7.11.1 PDB: 1y01_A* 1w0b_A 3ovu_A* 1w09_A 1w0a_A 3ia3_A* 1xzy_A
Probab=34.09  E-value=1.8  Score=35.40  Aligned_cols=60  Identities=17%  Similarity=0.418  Sum_probs=43.2

Q ss_pred             CCcccccCCCHhHHHHHhhcccccceEEEEeeeeeCCeEEEEcccCCh---HHHHHHHHHHHHHHh---cCCceEEEE
Q 020057          148 QQLDEYIRIPKETIDILKDQVFGFDTFFVTNQEPYEGGVLFKGNLRGQ---AAKTYEKISTRMKNK---FGDQYKLFL  219 (331)
Q Consensus       148 ~~~~~~~~ip~EdLk~IK~~~FG~dTFfvT~~e~~~qGVIfRGNLRg~---pEevy~kL~~kLee~---fGDrY~LfL  219 (331)
                      +|.-....||+||+..+-++   |--||+.         -||-+++|+   .|.+.+.+++.|...   |=+||+-||
T Consensus        24 QQvF~~~~i~ee~MvtvV~D---WvnfYin---------yy~~~~~GeqqEqdrAlqel~qeL~tl~~pFL~KYR~fL   89 (102)
T 1z8u_A           24 QQVFNDALVSEEDMVTVVED---WMNFYIN---------YYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFL   89 (102)
T ss_dssp             TCCGGGCCCCHHHHHHHHHH---HHHHHHH---------HHTTTCCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHTTT
T ss_pred             hcccCCCCCCHHHHHHHHHH---HHHHHHH---------HHHHHhcccHHHHHHHHHHHHHHHHHHhhHHHHHHHHHH
Confidence            44444556999999998874   7777652         245678886   567888888888766   558898664


No 18 
>2rjp_A Adamts-4; metalloprotease domain, aggrecanase, cleavage on PAIR of basic residues, extracellular matrix, glycoprotein, hydrolase, metal-binding; HET: 886; 2.80A {Homo sapiens} PDB: 3b2z_A
Probab=34.03  E-value=15  Score=33.93  Aligned_cols=17  Identities=24%  Similarity=0.513  Sum_probs=12.5

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 020057          295 ALVIGVHELGHILAAKS  311 (331)
Q Consensus       295 l~ILgvHE~GHylaArr  311 (331)
                      +++..+|||||-+=+..
T Consensus       143 ~a~t~AHElGHnlGm~H  159 (316)
T 2rjp_A          143 SAFTAAHQLGHVFNMLH  159 (316)
T ss_dssp             HHHHHHHHHHHHTTCCC
T ss_pred             HHHHHHHHHHhhcCccC
Confidence            34667999999886543


No 19 
>2rjq_A Adamts-5; metalloprotease domain, aggrecanase, cleavage on PAIR of BAS residues, extracellular matrix, glycoprotein, hydrolase, ME binding; HET: NAG BAT; 2.60A {Homo sapiens}
Probab=33.02  E-value=15  Score=34.59  Aligned_cols=17  Identities=35%  Similarity=0.560  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 020057          295 ALVIGVHELGHILAAKS  311 (331)
Q Consensus       295 l~ILgvHE~GHylaArr  311 (331)
                      +++..+|||||-|=+..
T Consensus       143 ~a~~~AHElGHnlGm~H  159 (378)
T 2rjq_A          143 AAFTVAHEIGHLLGLSH  159 (378)
T ss_dssp             HHHHHHHHHHHHTTCCC
T ss_pred             hhhhhhhhhhhhcCccC
Confidence            34667999999886553


No 20 
>2ejq_A Hypothetical protein TTHA0227; NPPSFA, national project on protein structural and functional analyses; 2.08A {Thermus thermophilus} SCOP: d.92.1.17
Probab=32.68  E-value=23  Score=29.73  Aligned_cols=19  Identities=32%  Similarity=0.275  Sum_probs=12.9

Q ss_pred             HHHHHHHHHHHHH--HHHHcC
Q 020057          295 ALVIGVHELGHIL--AAKSTG  313 (331)
Q Consensus       295 l~ILgvHE~GHyl--aArr~g  313 (331)
                      +..-.+||+||++  .|..+|
T Consensus        89 V~~tvvHEiaHhfe~lag~~g  109 (130)
T 2ejq_A           89 VWETMLHELRHHLESLAGRDD  109 (130)
T ss_dssp             HHHHHHHHHHHHHHHHHTTC-
T ss_pred             HHHHHHHHhHHHHHhhcccCC
Confidence            3456699999999  555444


No 21 
>4dd8_A Disintegrin and metalloproteinase domain-containi 8; batimastat, inflammation, alpha/beta motif, metalloproteinas allergic asthma, tumorigenesis; HET: BAT; 2.10A {Homo sapiens}
Probab=32.37  E-value=21  Score=30.88  Aligned_cols=16  Identities=31%  Similarity=0.441  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHHHH
Q 020057          296 LVIGVHELGHILAAKS  311 (331)
Q Consensus       296 ~ILgvHE~GHylaArr  311 (331)
                      ++..+||+||-+=+..
T Consensus       134 a~~~AHElGH~lG~~H  149 (208)
T 4dd8_A          134 ACTMAHEMGHNLGMDH  149 (208)
T ss_dssp             HHHHHHHHHHHTTCCC
T ss_pred             HHHHHHHHHHHcCCcC
Confidence            4667999999886543


No 22 
>2jsd_A Matrix metalloproteinase-20; MMP-NNGH, structural genomics, structural proteomics in europe, spine, spine-2, spine2-complexes, hydrolase; HET: NGH; NMR {Homo sapiens}
Probab=32.17  E-value=21  Score=29.45  Aligned_cols=15  Identities=33%  Similarity=0.603  Sum_probs=10.8

Q ss_pred             HHHHHHHHHHHHHcC
Q 020057          299 GVHELGHILAAKSTG  313 (331)
Q Consensus       299 gvHE~GHylaArr~g  313 (331)
                      .+|||||-+=-..-.
T Consensus       112 ~~HEiGHaLGL~H~~  126 (160)
T 2jsd_A          112 AAHEFGHALGLAHST  126 (160)
T ss_dssp             HHHHHHHHHTCCCCC
T ss_pred             HHHHhHhhhcCCCCC
Confidence            489999998654333


No 23 
>2ero_A VAP-1, vascular apoptosis-inducing protein 1; metalloprotease, disintegrin, calcium-binding, ADAM, SVMP, M protein, toxin; HET: NAG; 2.50A {Crotalus atrox} PDB: 2erp_A* 2erq_A*
Probab=31.83  E-value=17  Score=35.30  Aligned_cols=18  Identities=28%  Similarity=0.423  Sum_probs=13.3

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q 020057          294 TALVIGVHELGHILAAKS  311 (331)
Q Consensus       294 ll~ILgvHE~GHylaArr  311 (331)
                      .+++..+|||||-|=+..
T Consensus       145 ~~a~t~AHElGHnlG~~H  162 (427)
T 2ero_A          145 LVAIAMAHEMGHNLGMDH  162 (427)
T ss_dssp             HHHHHHHHHHHHHTTCCC
T ss_pred             HHHHHHHHHHHHhcCCcc
Confidence            335667999999886654


No 24 
>1hy7_A Stromelysin-1, MMP-3; mixed alpha beta structure, zinc protease, inhibited, hydrol; HET: MBS; 1.50A {Homo sapiens} SCOP: d.92.1.11 PDB: 1biw_A* 1bm6_A* 1bqo_A* 1b3d_A* 1cqr_A 1d5j_A* 1d7x_A* 1d8f_A* 1d8m_A* 1g05_A* 1g49_A* 1c3i_A* 1sln_A* 1uea_A 2srt_A* 1ums_A* 1umt_A* 2d1o_A* 3oho_A* 1ciz_A* ...
Probab=31.12  E-value=22  Score=30.03  Aligned_cols=16  Identities=31%  Similarity=0.488  Sum_probs=11.3

Q ss_pred             HHHHHHHHHHHHHcCC
Q 020057          299 GVHELGHILAAKSTGV  314 (331)
Q Consensus       299 gvHE~GHylaArr~gV  314 (331)
                      .+|||||-+=-..-..
T Consensus       117 ~~HEiGHaLGL~H~~~  132 (173)
T 1hy7_A          117 AAHEIGHSLGLFHSAN  132 (173)
T ss_dssp             HHHHHHHHHTBCCCSC
T ss_pred             HHHHHHHhhcCCCCCC
Confidence            4899999986544333


No 25 
>2e3x_A Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis}
Probab=30.71  E-value=20  Score=34.97  Aligned_cols=17  Identities=41%  Similarity=0.434  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 020057          295 ALVIGVHELGHILAAKS  311 (331)
Q Consensus       295 l~ILgvHE~GHylaArr  311 (331)
                      +++..+|||||-|=+..
T Consensus       139 ~a~t~AHElGHnlGm~H  155 (427)
T 2e3x_A          139 TAVIMAHELSHNLGMYH  155 (427)
T ss_dssp             HHHHHHHHHHHTTTCCC
T ss_pred             eeeehHHHHHHhhCCcc
Confidence            35667999999876553


No 26 
>1r55_A ADAM 33; metalloprotease, inhibitor, asthma, hydrolase; HET: NAG MAN 097; 1.58A {Homo sapiens} SCOP: d.92.1.9 PDB: 1r54_A*
Probab=30.47  E-value=19  Score=31.39  Aligned_cols=16  Identities=31%  Similarity=0.445  Sum_probs=12.3

Q ss_pred             HHHHHHHHHHHHHHHH
Q 020057          296 LVIGVHELGHILAAKS  311 (331)
Q Consensus       296 ~ILgvHE~GHylaArr  311 (331)
                      ++..+|||||-+=+..
T Consensus       137 a~~~AHElGHnlG~~H  152 (214)
T 1r55_A          137 AATMAHEIGHSLGLSH  152 (214)
T ss_dssp             HHHHHHHHHHHTTCCC
T ss_pred             HHHHHHHHHHhcCCcC
Confidence            5667999999886553


No 27 
>2dw0_A Catrocollastatin; apoptotic toxin, SVMP, metalloproteinase, apoptosis, toxin; HET: NAG BMA MAN GM6; 2.15A {Crotalus atrox} PDB: 2dw1_A* 2dw2_A* 3dsl_A* 3hdb_A*
Probab=30.25  E-value=19  Score=34.97  Aligned_cols=17  Identities=41%  Similarity=0.577  Sum_probs=12.9

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 020057          295 ALVIGVHELGHILAAKS  311 (331)
Q Consensus       295 l~ILgvHE~GHylaArr  311 (331)
                      +++..+|||||-|=+..
T Consensus       137 ~a~t~AHElGHnlG~~H  153 (419)
T 2dw0_A          137 VAVIMAHEMGHNLGINH  153 (419)
T ss_dssp             HHHHHHHHHHHHTTCCC
T ss_pred             hhhhHHHHHHHHcCCcc
Confidence            35667999999886654


No 28 
>2i47_A ADAM 17; TACE-inhibitor complex, hydrolase; HET: INN KGY; 1.90A {Homo sapiens} SCOP: d.92.1.10 PDB: 3g42_A*
Probab=30.11  E-value=20  Score=32.52  Aligned_cols=17  Identities=41%  Similarity=0.618  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 020057          295 ALVIGVHELGHILAAKS  311 (331)
Q Consensus       295 l~ILgvHE~GHylaArr  311 (331)
                      .++..+|||||-|=+..
T Consensus       188 ~a~~~AHElGHnlGm~H  204 (288)
T 2i47_A          188 ADLVTTHELGHNFGAEH  204 (288)
T ss_dssp             HHHHHHHHHHHHTTCCC
T ss_pred             HHHHHHHHHHhhcCCcc
Confidence            45677999999987654


No 29 
>3c37_A Peptidase, M48 family; Q74D82, GSR143A, structural genomics, protein structure initiative, northeast structural genomics consortium; 1.70A {Geobacter sulfurreducens pca}
Probab=29.80  E-value=22  Score=31.91  Aligned_cols=13  Identities=38%  Similarity=0.585  Sum_probs=9.2

Q ss_pred             HHHHHHHHHHHHHH
Q 020057          294 TALVIGVHELGHIL  307 (331)
Q Consensus       294 ll~ILgvHE~GHyl  307 (331)
                      +.+|| +||+||+.
T Consensus       100 LaaVL-aHElgH~~  112 (253)
T 3c37_A          100 LAGVL-AHEINHAV  112 (253)
T ss_dssp             HHHHH-HHHHHHHH
T ss_pred             HHHHH-HHHHHHHH
Confidence            33444 89999984


No 30 
>1c7k_A NCNP, zinc endoprotease; alpha and beta protein, metalloproteinase, hydrolase; 1.00A {Streptomyces caespitosus} SCOP: d.92.1.1 PDB: 1kuh_A
Probab=28.89  E-value=26  Score=29.60  Aligned_cols=11  Identities=45%  Similarity=0.927  Sum_probs=8.9

Q ss_pred             HHHHHHHHHHH
Q 020057          298 IGVHELGHILA  308 (331)
Q Consensus       298 LgvHE~GHyla  308 (331)
                      ..+||+||-+-
T Consensus        80 v~aHE~GH~LG   90 (132)
T 1c7k_A           80 VTAHETGHVLG   90 (132)
T ss_dssp             HHHHHHHHHHT
T ss_pred             EEeeeehhccC
Confidence            46999999863


No 31 
>1i76_A MMP-8;, neutrophil collagenase; hydrolase, complex (metalloprotease/inhibitor); HET: BSI; 1.20A {Homo sapiens} SCOP: d.92.1.11 PDB: 1i73_A* 1jao_A* 1jap_A 1jaq_A* 1jj9_A* 1mmb_A* 1zp5_A* 1zs0_A* 1zvx_A* 3dng_A* 3dpe_A* 3dpf_A* 1kbc_A* 1jan_A* 1bzs_A* 1mnc_A* 2oy2_A 1a86_A* 1jh1_A* 1a85_A ...
Probab=27.42  E-value=28  Score=29.22  Aligned_cols=16  Identities=31%  Similarity=0.640  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHHHHHcC
Q 020057          298 IGVHELGHILAAKSTG  313 (331)
Q Consensus       298 LgvHE~GHylaArr~g  313 (331)
                      ..+||+||-+--..-.
T Consensus       115 v~~HE~GHalGl~H~~  130 (163)
T 1i76_A          115 VAAHEFGHSLGLAHSS  130 (163)
T ss_dssp             HHHHHHHHHHTBCCCS
T ss_pred             hhHHHhhhhhcCCCCC
Confidence            3589999998655433


No 32 
>1cge_A Fibroblast collagenase; hydrolase (metalloprotease); 1.90A {Homo sapiens} SCOP: d.92.1.11 PDB: 2j0t_A 1ayk_A 1hfc_A* 2ayk_A 2tcl_A* 3ayk_A* 4ayk_A* 1cgl_A* 1cgf_A 966c_A* 3shi_A
Probab=27.31  E-value=23  Score=29.80  Aligned_cols=13  Identities=46%  Similarity=0.723  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHHHH
Q 020057          299 GVHELGHILAAKS  311 (331)
Q Consensus       299 gvHE~GHylaArr  311 (331)
                      .+|||||-+=-..
T Consensus       115 ~~HEiGHaLGL~H  127 (168)
T 1cge_A          115 AAHELGHSLGLSH  127 (168)
T ss_dssp             HHHHHHHHTTCCC
T ss_pred             hhhHhHhhhcCCC
Confidence            5899999875543


No 33 
>1hv5_A Stromelysin 3; inhibition, phosphinic inhibitor, hydrolase; HET: CPS RXP; 2.60A {Mus musculus} SCOP: d.92.1.11
Probab=27.01  E-value=24  Score=29.59  Aligned_cols=17  Identities=35%  Similarity=0.728  Sum_probs=11.7

Q ss_pred             HHHHHHHHHHHHHHcCC
Q 020057          298 IGVHELGHILAAKSTGV  314 (331)
Q Consensus       298 LgvHE~GHylaArr~gV  314 (331)
                      ..+||+||-+=-..-..
T Consensus       116 v~~HEiGHaLGL~H~~~  132 (165)
T 1hv5_A          116 VAAHEFGHVLGLQHTTA  132 (165)
T ss_dssp             HHHHHHHHHTTCCCCSC
T ss_pred             hHHHHhHhhhCCCCCCC
Confidence            35899999876544433


No 34 
>2isb_A Fumarase, FUM-1; NP_069927.1, fumarase of FUM-1, structural genomics, PSI-2, structure initiative, joint center for structural genomics; HET: MSE; 1.66A {Archaeoglobus fulgidus} SCOP: c.8.9.1
Probab=26.96  E-value=46  Score=30.02  Aligned_cols=60  Identities=20%  Similarity=0.175  Sum_probs=43.3

Q ss_pred             ccCCCHhHHHHHhhcccccceEEEEeeeeeCCeEEEEcccCChHHHHHHHHHHHHHHhcCCceEEEEEecCCCCCceEEE
Q 020057          153 YIRIPKETIDILKDQVFGFDTFFVTNQEPYEGGVLFKGNLRGQAAKTYEKISTRMKNKFGDQYKLFLLVNPEDDKPVAVV  232 (331)
Q Consensus       153 ~~~ip~EdLk~IK~~~FG~dTFfvT~~e~~~qGVIfRGNLRg~pEevy~kL~~kLee~fGDrY~LfLvee~edgKPV~vV  232 (331)
                      ..||.+||++.||-                ++-|...|.+-.-++.+|++|.+.|++  |.+.- +   + ..++.++.+
T Consensus        20 ~~Plt~e~v~~L~v----------------GD~V~LsG~i~taRDaAHkRl~e~l~~--Ge~lP-~---d-l~g~~Iyy~   76 (192)
T 2isb_A           20 RTPLVKDQILKLKV----------------GDVVYITGEIFTARDEAHARALEWMEE--GKELP-F---S-FDKGVVYHC   76 (192)
T ss_dssp             ESSCCHHHHHHCCT----------------TCEEEEEEEEEECCHHHHHHHHHHHHH--TCCCS-S---C-CTTCEEECB
T ss_pred             CCCCCHHHHhhCCC----------------CCEEEEEEEEEEEhHHHHHHHHHHHHc--CCCCC-c---C-CCCCEEEEe
Confidence            45889999999995                677788888888889999999999976  43322 1   1 235566555


Q ss_pred             ecC
Q 020057          233 VPR  235 (331)
Q Consensus       233 lP~  235 (331)
                      -|.
T Consensus        77 GP~   79 (192)
T 2isb_A           77 GPL   79 (192)
T ss_dssp             CCE
T ss_pred             cCC
Confidence            554


No 35 
>4axq_A Archaemetzincin; metalloprotease, protease, hydrolase, metal-bindi; 1.40A {Archaeoglobus fulgidus} PDB: 2xhq_A 3zvs_A 4a3w_A*
Probab=26.53  E-value=24  Score=30.42  Aligned_cols=18  Identities=17%  Similarity=0.292  Sum_probs=14.5

Q ss_pred             hHHHHHHHHHHHHHHhcC
Q 020057          195 QAAKTYEKISTRMKNKFG  212 (331)
Q Consensus       195 ~pEevy~kL~~kLee~fG  212 (331)
                      -.++.-+.+++.|++.||
T Consensus        13 v~~~~l~~l~~~l~~~~g   30 (163)
T 4axq_A           13 VNSHTVEVLANSLPKIFN   30 (163)
T ss_dssp             CCHHHHHHHHHHHHHHHT
T ss_pred             CCHHHHHHHHHHHHHHhC
Confidence            345778889999999988


No 36 
>1rm8_A MMP-16, matrix metalloproteinase-16, MT3-MMP; membrane type - matrix metalloproteinase, batimastat, hydroxamate inhibitor, protease, hydrolase; HET: BAT; 1.80A {Homo sapiens} SCOP: d.92.1.11
Probab=26.27  E-value=30  Score=28.99  Aligned_cols=16  Identities=44%  Similarity=0.804  Sum_probs=11.8

Q ss_pred             HHHHHHHHHHHHHHcC
Q 020057          298 IGVHELGHILAAKSTG  313 (331)
Q Consensus       298 LgvHE~GHylaArr~g  313 (331)
                      ..+||+||.+--....
T Consensus       120 ~~~he~gh~lgl~h~~  135 (169)
T 1rm8_A          120 VAVHELGHALGLEHSN  135 (169)
T ss_dssp             HHHHHHHHHHTCCCCS
T ss_pred             ehhhhhhhhcCCCCCC
Confidence            3589999998765433


No 37 
>2y6d_A Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapiens} PDB: 2ddy_A* 1mmq_A* 1mmp_A* 1mmr_A* 2y6c_A*
Probab=25.04  E-value=33  Score=29.23  Aligned_cols=16  Identities=38%  Similarity=0.563  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHHHHHHc
Q 020057          297 VIGVHELGHILAAKST  312 (331)
Q Consensus       297 ILgvHE~GHylaArr~  312 (331)
                      -..+||+||-+--...
T Consensus       117 ~~~~HE~gH~lGl~h~  132 (174)
T 2y6d_A          117 YAATHELGHSLGMGHS  132 (174)
T ss_dssp             HHHHHHHHHHHTBCCC
T ss_pred             ehhhHHhHhhhcCCCC
Confidence            3458999999865443


No 38 
>3k7n_A K-like; SVMP, hydrolase; HET: NAG FUC FUL; 2.30A {Naja atra}
Probab=24.59  E-value=31  Score=33.38  Aligned_cols=16  Identities=38%  Similarity=0.428  Sum_probs=11.9

Q ss_pred             HHHHHHHHHHHHHHHH
Q 020057          295 ALVIGVHELGHILAAK  310 (331)
Q Consensus       295 l~ILgvHE~GHylaAr  310 (331)
                      +++..+|||||-+=+.
T Consensus       139 ~a~t~AHElGHnlGm~  154 (397)
T 3k7n_A          139 VASTITHELGHNLGIH  154 (397)
T ss_dssp             HHHHHHHHHHHHTTCC
T ss_pred             hhhhHHHHHHHHcCCc
Confidence            3466699999987554


No 39 
>1y93_A Macrophage metalloelastase; matrix metalloproteinase, MMP12, complex (elastase inhibitor), acetohydroxamic acid, hydrola; 1.03A {Homo sapiens} SCOP: d.92.1.11 PDB: 1rmz_A 1ycm_A* 1z3j_A* 2hu6_A* 2oxu_A 2oxw_A 2oxz_A 3lik_A* 3lil_A* 3lir_A* 3ljg_A* 1os9_A 1os2_A 3f17_A* 3ehy_A* 3ehx_A* 3f15_A* 3f16_A* 3f18_A* 3f19_A* ...
Probab=23.55  E-value=30  Score=28.95  Aligned_cols=14  Identities=43%  Similarity=0.679  Sum_probs=10.6

Q ss_pred             HHHHHHHHHHHHHH
Q 020057          298 IGVHELGHILAAKS  311 (331)
Q Consensus       298 LgvHE~GHylaArr  311 (331)
                      ..+||+||-+--..
T Consensus       111 ~~~HE~GH~lGl~H  124 (159)
T 1y93_A          111 TAVHEIGHSLGLGH  124 (159)
T ss_dssp             HHHHHHHHHTTCCC
T ss_pred             hhhhhhhhhhcCCC
Confidence            35899999986543


No 40 
>3k7l_A Atragin; SVMP, metalloprotease, hydrolase; HET: NAG; 2.50A {Naja atra}
Probab=23.19  E-value=34  Score=33.41  Aligned_cols=16  Identities=31%  Similarity=0.517  Sum_probs=11.4

Q ss_pred             HHHHHHHHHHHHHHHH
Q 020057          295 ALVIGVHELGHILAAK  310 (331)
Q Consensus       295 l~ILgvHE~GHylaAr  310 (331)
                      +++..+|||||-+=+.
T Consensus       144 ~a~t~AHElGHnlGm~  159 (422)
T 3k7l_A          144 VAITMAHEMGHNLGMN  159 (422)
T ss_dssp             HHHHHHHHHHHHTTCC
T ss_pred             hhHHHHHHHHHHcCCc
Confidence            4466799999976443


No 41 
>3ayu_A 72 kDa type IV collagenase; protease, hydrolase-hydrolase inhibitor complex; 2.00A {Homo sapiens} PDB: 1qib_A 1hov_A*
Probab=22.77  E-value=32  Score=29.10  Aligned_cols=17  Identities=18%  Similarity=0.475  Sum_probs=11.9

Q ss_pred             HHHHHHHHHHHHHHcCC
Q 020057          298 IGVHELGHILAAKSTGV  314 (331)
Q Consensus       298 LgvHE~GHylaArr~gV  314 (331)
                      ..+||+||-+--.....
T Consensus       117 ~~~HE~gH~lGl~H~~~  133 (167)
T 3ayu_A          117 VAAHAFGHAMGLEHSQD  133 (167)
T ss_dssp             HHHHHHHHHTTEECCSC
T ss_pred             ehhhhhHHhccCCCCCC
Confidence            45899999886554333


No 42 
>3dte_A IRRE protein; radiotolerance, gene regulation, metallopeptidase; 2.60A {Deinococcus deserti} PDB: 3dti_A 3dtk_A
Probab=21.85  E-value=33  Score=32.37  Aligned_cols=13  Identities=31%  Similarity=0.350  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHHHH
Q 020057          298 IGVHELGHILAAK  310 (331)
Q Consensus       298 LgvHE~GHylaAr  310 (331)
                      -.+||+||++.-.
T Consensus        99 TLAHELGHllLh~  111 (301)
T 3dte_A           99 TLAHEISHALLLG  111 (301)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhcc
Confidence            3489999999764


No 43 
>830c_A MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A {Homo sapiens} SCOP: d.92.1.11 PDB: 456c_A* 1you_A* 4a7b_A* 3tvc_A* 1eub_A* 1xuc_A* 1xud_A* 1xur_A* 2yig_A* 3elm_A* 3i7g_A* 3i7i_A* 3zxh_A* 2ow9_A* 2ozr_A* 3kek_A* 3kej_A* 3kec_A* 2d1n_A* 1fls_A* ...
Probab=20.43  E-value=38  Score=28.94  Aligned_cols=18  Identities=28%  Similarity=0.495  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHHHHcCCc
Q 020057          298 IGVHELGHILAAKSTGVE  315 (331)
Q Consensus       298 LgvHE~GHylaArr~gVk  315 (331)
                      .++||+||.+--.....+
T Consensus       116 v~~hE~Gh~lGl~h~~~~  133 (168)
T 830c_A          116 VAAHEFGHSLGLDHSKDP  133 (168)
T ss_dssp             HHHHHHHHHTTBCCCSCT
T ss_pred             hhhhhhcchhcCCCCCCC
Confidence            358999999875544443


No 44 
>1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11
Probab=20.40  E-value=37  Score=30.93  Aligned_cols=17  Identities=29%  Similarity=0.520  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHHHHHcCC
Q 020057          298 IGVHELGHILAAKSTGV  314 (331)
Q Consensus       298 LgvHE~GHylaArr~gV  314 (331)
                      .++|||||-+=-..-..
T Consensus       198 va~HEiGHaLGL~Hs~~  214 (255)
T 1slm_A          198 VAAHEIGHSLGLFHSAN  214 (255)
T ss_dssp             HHHHHHHHHTTCCCCSC
T ss_pred             hhHHHHHHHhcCCCCCC
Confidence            34899999876544333


Done!