Citrus Sinensis ID: 020108

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-
MGSLKNETENEVNQREQGEQEQEDQEPILMEQNQRFCMFPIRYKQVWEMYKKAQASFWTAEEVDLSQDVQHWERLLDSEKHFISHVLAFFAASDGIVLENLAARFLNDIQIPEARAFYGFQIAMENIHSEMYSLLLETYIKDSKEKHRLFNAIENIPCVAQKAKWALDWIHSSDSFAERLVGFACVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLRKRLHWQKVHHMVHEAVEIETQFVCEALPCALIGMNSSLMSQYIKFVADRLLVHIHQCSLFIIACVKGIARAGLFFPFLLSGCIRVPEEVQCGKSF
cccccccccHHHHHHHccccccccccccccccccccCCcccccHHHHHHHHHHHHcccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccc
*****************************MEQNQRFCMFPIRYKQVWEMYKKAQASFWTAEEVDLSQDVQHWERLLDSEKHFISHVLAFFAASDGIVLENLAARFLNDIQIPEARAFYGFQIAMENIHSEMYSLLLETYIKDSKEKHRLFNAIENIPCVAQKAKWALDWIHSSDSFAERLVGFACVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLRKRLHWQKVHHMVHEAVEIETQFVCEALPCALIGMNSSLMSQYIKFVADRLLVHIHQCSLFIIACVKGIARAGLFFPFLLSGCIRVPEEV******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSLxxxxxxxxxxxxxxxxxxxxxEPILMEQNQRFCMFPIRYKQVWEMYKKAQASFWTAEEVDLSQDVQHWERLLDSEKHFISHVLAFFAASDGIVLENLAARFLNDIQIPEARAFYGFQIAMENIHSEMYSLLLETYIKDSKEKHRLFNAIENIPCVAQKAKWALDWIHSSDSFAERLVGFACVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLRKRLHWQKVHHMVHEAVEIETQFVCEALPCALIGMNSSLMSQYIKFVADRLLVHIHQCSLFIIACVKGIARAGLFFPFLLSGCIRVPEEVQCGKSF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ribonucleoside-diphosphate reductase small chain A Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides.confidentP50651
Ribonucleoside-diphosphate reductase small subunit Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides.probableP42521
Ribonucleoside-diphosphate reductase small chain Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides.probableQ8SRR2

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.17.-.-Acting on CH or CH(2) groups.probable
1.17.4.-With a disulfide as acceptor.probable
1.17.4.1Ribonucleoside-diphosphate reductase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P1I, chain A
Confidence level:very confident
Coverage over the Query: 42-305
View the alignment between query and template
View the model in PyMOL