Citrus Sinensis ID: 020120


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-
MAAEATTTKFQNPDFRPVPQPPDFHPEIAVTAHDGLRYWQFMIAGSIAGSVEHMAMFPVDTVKTHMQAIGSCPIKSVGVRQALKSILKTEGPSGLYRGIGAMGLGAGPAHAVYFSIYEVSKKFLSAGNPNNAVAHAISGVFATVASDAVFTPMDMVKQRLQLGENSTYKGVWDCVKRVLREEGLGAFYASYRTTVLMNAPFTAVHFATYEATKRGLMEISPESASDERLVVHATAGAAAGALAAAVTTPLDVVKTQLQCQGVCGCDRFQSSSIGHVIQTIIKKDGYRGLIRGWMPRMLFHAPAAAICWSTYEACKSFFEEVNDSSNSSTIT
cccccccccccccccccccccccccHHHHccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccccccHHHHHHHHHHHccccccccccHHHHHcHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHEECccHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
*****TT**FQNPDFRPVP******PEIAVTAHDGLRYWQFMIAGSIAGSVEHMAMFPVDTVKTHMQAIGSCPIKSVGVRQALKSILKTEGPSGLYRGIGAMGLGAGPAHAVYFSIYEVSKKFLSAGNPNNAVAHAISGVFATVASDAVFTPMDMVKQRLQLGENSTYKGVWDCVKRVLREEGLGAFYASYRTTVLMNAPFTAVHFATYEATKRGLMEISPESASDERLVVHATAGAAAGALAAAVTTPLDVVKTQLQCQGVCGCDRFQSSSIGHVIQTIIKKDGYRGLIRGWMPRMLFHAPAAAICWSTYEACKSFFE************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAEATTTKFQNPDFRPVPQPPDFHPEIAVTAHDGLRYWQFMIAGSIAGSVEHMAMFPVDTVKTHMQAIGSCPIKSVGVRQALKSILKTEGPSGLYRGIGAMGLGAGPAHAVYFSIYEVSKKFLSAGNPNNAVAHAISGVFATVASDAVFTPMDMVKQRLQLGENSTYKGVWDCVKRVLREEGLGAFYASYRTTVLMNAPFTAVHFATYEATKRGLMEISPESASDERLVVHATAGAAAGALAAAVTTPLDVVKTQLQCQGVCGCDRFQSSSIGHVIQTIIKKDGYRGLIRGWMPRMLFHAPAAAICWSTYEACKSFFEEVNDSSNSSTIT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitoferrin Mitochondrial iron transporter that mediates iron uptake. Probably required for heme synthesis of hemoproteins and Fe-S cluster assembly.probableQ23125
Mitoferrin Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. Mitochondrial iron transporter that mediates iron uptake. Probably required for heme synthesis of hemoproteins and Fe-S cluster assembly.probableQ55DY8
Mitoferrin-1 Mitochondrial iron transporter that specifically mediates iron uptake in developing erythroid cells, thereby playing an essential role in heme biosynthesis. The iron delivered into the mitochondria, presumably as Fe(2+), is then probably delivered to ferrochelatase to catalyze Fe(2+) incorporation into protoprophyrin IX to make heme.probableQ287T7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OKC, chain A
Confidence level:very confident
Coverage over the Query: 130-321
View the alignment between query and template
View the model in PyMOL
Template: 1OKC, chain A
Confidence level:very confident
Coverage over the Query: 36-314
View the alignment between query and template
View the model in PyMOL