Citrus Sinensis ID: 020133

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330

MDRSAMTVGPGMDMPIMHDSDRYELVRDIGSGNFGVARLMRDKKTEELVAVKYIERGDKIDENVQREIINHRSLRHPNIVRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCHRDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYIAPEVLLKKEYDGKIADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRISIPEIRNHEWFLKNLPADLVVDNTTNNQFEEPDQPMQSIDEIMQIIAEATIPAAGTQSLNQCLNGSLDIDDEMDEDIDTDPDLDIDSSGEIVYAM

ccccccccccccccccccccccEEEEEEEcccccEEEEEEEEcccccEEEEEEEEccccccHHHHHHHHHHHHcccccEEEEEEEEEcccEEEEEEEEcccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccCEEEccccccccccccccccccccccccccHHccccccccccccEEcHHHHHHHHHHccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccHHcccccccccccccccccccccccccccccEEEEc

*********************RYELVRDIGSGNFGVARLMRDKKTEELVAVKYIERGDKIDENVQREIINHRSLRHPNIVRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVCHRDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYIAPEVLLKKEYDGKIADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRISIPEIRNHEWFLKNLPADLVVDNT****************EIMQIIAEATIPAAGTQSLNQCLNGSLDIDDEMD**I*TDP*LDIDSSGEIVYAM

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Serine/threonine-protein kinase SAPK10	May play a role in signal transduction of hyperosmotic response.	confident	Q75H77
Serine/threonine-protein kinase SRK2E	Activator of the abscisic acid (ABA) signaling pathway that regulates numerous ABA responses, such as stomata closure in response to drought, plant pathogens, or decreases in atmospheric relative humidity (RH). Involved in the resistance to drought by avoiding water loss. Required for the stomata closure mediated by pathogen-associated molecular pattern (PAMPs) (e.g. flg22 and LPS) of pathogenic bacteria such as P.syringae pv. tomato (Pst) and E.coli O157:H7. As a plant defense process, stomata are closed transiently in order to limit invaders, but actively reopened by bacteria after a few hours; virulent strains (e.g. Pst DC3000) are more efficient than avirulent strains (e.g. Pst DC3000 AvrRpt2) in reopening stomata. Mediates the phosphorylation and activation of the S-type anion efflux channel SLAC1, and thus promotes stomata closure. Essential for stomatal closure in response to reactive oxygen species (ROS).	confident	Q940H6
Abscisic acid-inducible protein kinase (Fragment)	Involved in water-stress responses.	probable	Q02066

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.7.-.-	Transferring phosphorous-containing groups.	probable
2.7.11.-	Protein-serine/threonine kinases.	probable
2.7.11.1	Transferred entry: 2.7.11.19.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UC3, chain A
Confidence level:very confident
Coverage over the Query: 12-166,182-253,272-287
View the alignment between query and template
View the model in PyMOL