Citrus Sinensis ID: 020140


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330
MGSLPCVVEDMGGVLQLYSDGTVFRSKDIKFNMQLIDQNDESSVFFKDCQYDKIHDLHLRLYKPRSETTSSPLSKAKLPIVVFIHGGGFCAGSREWPNSHNCCFRLAAELNALVVALDYRLAPEHRLPAAMEDAFAAMKWLQAQALSENLNGDAWFDEVEFDNVFVLGDSSGGNIAHHLAVQLGGGSSELAPVRVRGYVLLAPFFGGVARTKSELGPSEAMLNLELLDSFWRLSLPIGETRDHPYANPFGPESPSLEVVSLDPMLVVASEIELLKDRAKDYAKRLKAMGKTIDFVEFKGQQHGFFTNEPFSEASNEFLKVVEKFMSENST
ccccccEEEcccccEEEEccccEEEccccccccccccccccccEEEEEEEEccccccEEEEEcccccccccccccccccEEEEEcccEEEEcccccccHHHHHHHHHHHcccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEccccHHHHHHHHHHHHccccccccccEEEEEEEcccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEccccccHHHHHHHHHHHHHccccEEEEEEcccEEEEEEcccccHHHHHHHHHHHHHHccccc
ccccccEEEccccEEEEEccccEEcccccccccccccccccccEEEEEEEEccccccEEEEEEccccccccccccccccEEEEEccccEEEcccccccHHHHHHHHHHHHccEEEEEEccccccccccHHHHHHHHHHHHHHHcHHHccccccccHccccccEEEEEccccHHHHHHHHHHHHHcccccccccEEEEEEEEEcccccccccccHcccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEccccHHHHHHHHHHHHHHHcccEEEEEEEcccEEEEEEcccccHHHHHHHHHHHHHHHHccc
mgslpcvvedmggvlqlysdgtvfrskdiKFNMqlidqndessvffkdcqydkiHDLHLRlykprsettssplskaklPIVVFIHgggfcagsrewpnshnCCFRLAAELNALVVALDyrlapehrlpAAMEDAFAAMKWLQAQALSEnlngdawfdevefDNVFvlgdssggniaHHLAVQlgggsselapvRVRGYVllapffggvartkselgpseAMLNLELLDSFwrlslpigetrdhpyanpfgpespslevvsldpMLVVASEIELLKDRAKDYAKRLKAMGKTIDfvefkgqqhgfftnepfseASNEFLKVVEKFMSENST
MGSLPCVVEDMGGVLQLYSDGTVFRSKDIKFNMQLIDQNDESSVFFKDCQYDKIHDLHLRLYKprsettssplskakLPIVVFIHGGGFCAGSREWPNSHNCCFRLAAELNALVVALDYRLAPEHRLPAAMEDAFAAMKWLQAQALSENLNGDAWFDEVEFDNVFVLGDSSGGNIAHHLAVQLGGGSSELAPVRVRGYVLLAPFFGGVARTKSELGPSEAMLNLELLDSFWRLSLPIGETRDHPYANPFGPESPSLEVVSLDPMLVVASEIELLKDRAKDYAKRLKAMGKTIDFVEFKGQQHGFFTNEPFSEASNEFLKVVEKFMSENST
MGSLPCVVEDMGGVLQLYSDGTVFRSKDIKFNMQLIDQNDESSVFFKDCQYDKIHDLHLRLYKPRSETTSSPLSKAKLPIVVFIHGGGFCAGSREWPNSHNCCFRlaaelnalvvalDYRLAPEHRLPAAMEDAFAAMKWLQAQALSENLNGDAWFDEVEFDNVFVLGDSSGGNIAHHLAVQLGGGSSELAPVRVRGYVLLAPFFGGVARTKSELGPSEAMLNLELLDSFWRLSLPIGETRDHPYANPFGPESPSLEVVSLDPMLVVASEIELLKDRAKDYAKRLKAMGKTIDFVEFKGQQHGFFTNEPFSEASNEFLKVVEKFMSENST
****PCVVEDMGGVLQLYSDGTVFRSKDIKFNMQLIDQNDESSVFFKDCQYDKIHDLHLRLYK************AKLPIVVFIHGGGFCAGSREWPNSHNCCFRLAAELNALVVALDYRLAPEHRLPAAMEDAFAAMKWLQAQALSENLNGDAWFDEVEFDNVFVLGDSSGGNIAHHLAVQLGGGSSELAPVRVRGYVLLAPFFGGVARTKSELGPSEAMLNLELLDSFWRLSLPIGETRD*************LEVVSLDPMLVVASEIELLKDRAKDYAKRLKAMGKTIDFVEFKGQQHGFFTNEPF******FLKV**********
***LPCVVEDMGGVLQLYSDGTVFRSKDIKFN**********SVFFKDCQYDKIHDLHLRLYKPRSET*****SKAKLPIVVFIHGGGFCAGSREWPNSHNCCFRLAAELNALVVALDYRLAPEHRLPAAMEDAFAAMKWLQAQALSENLNGDAWFDEVEFDNVFVLGDSSGGNIAHHLAVQLGGGSSELAPVRVRGYVLLAPFFGGVARTKSELGPSEAMLNLELLDSFWRLSLPIGETRDHPYANPFGPESPSLEVVSLDPMLVVASEIELLKDRAKDYAKRLKAMGKTIDFVEFKGQQHGFFTNEPFSEASNEFLKVVEKFMSEN**
MGSLPCVVEDMGGVLQLYSDGTVFRSKDIKFNMQLIDQNDESSVFFKDCQYDKIHDLHLRLYKP********LSKAKLPIVVFIHGGGFCAGSREWPNSHNCCFRLAAELNALVVALDYRLAPEHRLPAAMEDAFAAMKWLQAQALSENLNGDAWFDEVEFDNVFVLGDSSGGNIAHHLAVQLGGGSSELAPVRVRGYVLLAPFFGGVARTKSELGPSEAMLNLELLDSFWRLSLPIGETRDHPYANPFGPESPSLEVVSLDPMLVVASEIELLKDRAKDYAKRLKAMGKTIDFVEFKGQQHGFFTNEPFSEASNEFLKVVEKFMSENST
****PCVVEDMGGVLQLYSDGTVFRSKDIKFNMQLIDQNDESSVFFKDCQYDKIHDLHLRLYKPRSETTS****KAKLPIVVFIHGGGFCAGSREWPNSHNCCFRLAAELNALVVALDYRLAPEHRLPAAMEDAFAAMKWLQAQALSENLNGDAWFDEVEFDNVFVLGDSSGGNIAHHLAVQLGGGSSELAPVRVRGYVLLAPFFGGVARTKSELGPSEAMLNLELLDSFWRLSLPIGETRDHPYANPFGPESPSLEVVSLDPMLVVASEIELLKDRAKDYAKRLKAMGKTIDFVEFKGQQHGFFTNEPFSEASNEFLKVVEKFMSEN**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSLPCVVEDMGGVLQLYSDGTVFRSKDIKFNMQLIDQNDESSVFFKDCQYDKIHDLHLRLYKPRSETTSSPLSKAKLPIVVFIHGGGFCAGSREWPNSHNCCFRLAAELNALVVALDYRLAPEHRLPAAMEDAFAAMKWLQAQALSENLNGDAWFDEVEFDNVFVLGDSSGGNIAHHLAVQLGGGSSELAPVRVRGYVLLAPFFGGVARTKSELGPSEAMLNLELLDSFWRLSLPIGETRDHPYANPFGPESPSLEVVSLDPMLVVASEIELLKDRAKDYAKRLKAMGKTIDFVEFKGQQHGFFTNEPFSEASNEFLKVVEKFMSENST
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query330 2.2.26 [Sep-21-2011]
Q9FG13329 Probable carboxylesterase yes no 0.966 0.969 0.588 1e-99
Q9LFR7344 Probable carboxylesterase no no 0.869 0.834 0.332 1e-46
Q0ZPV7335 Carboxylesterase 1 OS=Act N/A no 0.909 0.895 0.338 2e-43
Q9SX25336 Probable carboxylesterase no no 0.833 0.818 0.372 1e-42
Q9LVB8327 Probable carboxylesterase no no 0.793 0.801 0.363 6e-41
Q9LYC1358 Gibberellin receptor GID1 no no 0.887 0.818 0.335 1e-37
O64640329 Probable carboxylesterase no no 0.9 0.902 0.333 2e-37
Q940G6344 Gibberellin receptor GID1 no no 0.818 0.784 0.333 3e-37
O64641324 Probable carboxylesterase no no 0.827 0.842 0.332 3e-36
Q9SX78314 Probable carboxylesterase no no 0.887 0.933 0.294 3e-34
>sp|Q9FG13|CXE15_ARATH Probable carboxylesterase 15 OS=Arabidopsis thaliana GN=CXE15 PE=2 SV=1 Back     alignment and function desciption
 Score =  363 bits (931), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 196/333 (58%), Positives = 244/333 (73%), Gaps = 14/333 (4%)

Query: 1   MGSL---PCVVEDMGGVLQLYSDGTVFRSKDIKFNMQLIDQNDESSVFFKDCQYDKIHDL 57
           MGSL   P V ED  G+LQL S+GTV RS+ I    Q I   +  +V FKD  Y K ++L
Sbjct: 1   MGSLGEEPQVAEDCMGLLQLLSNGTVLRSESIDLITQQIPFKNNQTVLFKDSIYHKPNNL 60

Query: 58  HLRLYKPRSETTSSPLSKAKLPIVVFIHGGGFCAGSREWPNSHNCCFRLAAELNALVVAL 117
           HLRLYKP S +     ++  LP+VVF HGGGFC GSR WP+ HN C  LA+ LNALVV+ 
Sbjct: 61  HLRLYKPISAS-----NRTALPVVVFFHGGGFCFGSRSWPHFHNFCLTLASSLNALVVSP 115

Query: 118 DYRLAPEHRLPAAMEDAFAAMKWLQAQALSENLNGDAWFDE---VEFDNVFVLGDSSGGN 174
           DYRLAPEHRLPAA EDA A + WL  QA+S+ +N   WF++   V+FD VFV+GDSSGGN
Sbjct: 116 DYRLAPEHRLPAAFEDAEAVLTWLWDQAVSDGVN--HWFEDGTDVDFDRVFVVGDSSGGN 173

Query: 175 IAHHLAVQLGGGSSELAPVRVRGYVLLAPFFGGVARTKSELGPSEAMLNLELLDSFWRLS 234
           IAH LAV+ G GS EL PVRVRGYVL+ PFFGG  RT SE GPSEA+L+L+LLD FWRLS
Sbjct: 174 IAHQLAVRFGSGSIELTPVRVRGYVLMGPFFGGEERTNSENGPSEALLSLDLLDKFWRLS 233

Query: 235 LPIGETRDHPYANPFGPESPSLEVVSLDPMLVVASEIELLKDRAKDYAKRLKAM-GKTID 293
           LP G TRDH  ANPFGP SP+LE +SL+PMLV+    ELL+DRAK+YA +LK M GK +D
Sbjct: 234 LPNGATRDHHMANPFGPTSPTLESISLEPMLVIVGGSELLRDRAKEYAYKLKKMGGKRVD 293

Query: 294 FVEFKGQQHGFFTNEPFSEASNEFLKVVEKFMS 326
           ++EF+ ++HGF++N P SEA+ + L+++  FM+
Sbjct: 294 YIEFENKEHGFYSNYPSSEAAEQVLRIIGDFMN 326




Carboxylesterase acting on esters with varying acyl chain length.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: 1
>sp|Q9LFR7|CXE17_ARATH Probable carboxylesterase 17 OS=Arabidopsis thaliana GN=CXE17 PE=2 SV=1 Back     alignment and function description
>sp|Q0ZPV7|CXE1_ACTER Carboxylesterase 1 OS=Actinidia eriantha GN=CXE1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SX25|CXE6_ARATH Probable carboxylesterase 6 OS=Arabidopsis thaliana GN=CXE6 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVB8|CXE20_ARATH Probable carboxylesterase 120 OS=Arabidopsis thaliana GN=CXE20 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYC1|GID1B_ARATH Gibberellin receptor GID1B OS=Arabidopsis thaliana GN=GID1B PE=1 SV=1 Back     alignment and function description
>sp|O64640|CXE8_ARATH Probable carboxylesterase 8 OS=Arabidopsis thaliana GN=CXE8 PE=2 SV=1 Back     alignment and function description
>sp|Q940G6|GID1C_ARATH Gibberellin receptor GID1C OS=Arabidopsis thaliana GN=GID1C PE=1 SV=1 Back     alignment and function description
>sp|O64641|CXE9_ARATH Probable carboxylesterase 9 OS=Arabidopsis thaliana GN=CXE9 PE=2 SV=1 Back     alignment and function description
>sp|Q9SX78|CXE2_ARATH Probable carboxylesterase 2 OS=Arabidopsis thaliana GN=CXE2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query330
224091491325 predicted protein [Populus trichocarpa] 0.978 0.993 0.677 1e-130
224138214325 predicted protein [Populus trichocarpa] 0.978 0.993 0.659 1e-128
255566245325 Gibberellin receptor GID1, putative [Ric 0.966 0.981 0.663 1e-128
296089309330 unnamed protein product [Vitis vinifera] 0.969 0.969 0.634 1e-120
225439293325 PREDICTED: probable carboxylesterase 15 0.969 0.984 0.634 1e-120
225439317320 PREDICTED: probable carboxylesterase 15 0.957 0.987 0.639 1e-119
296089323317 unnamed protein product [Vitis vinifera] 0.957 0.996 0.639 1e-119
356505457324 PREDICTED: probable carboxylesterase 15- 0.969 0.987 0.622 1e-110
225439319320 PREDICTED: probable carboxylesterase 15 0.966 0.996 0.6 1e-109
255573281328 Gibberellin receptor GID1, putative [Ric 0.957 0.963 0.594 1e-109
>gi|224091491|ref|XP_002309272.1| predicted protein [Populus trichocarpa] gi|222855248|gb|EEE92795.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 225/332 (67%), Positives = 278/332 (83%), Gaps = 9/332 (2%)

Query: 1   MGSLPCVVEDMGGVLQLYSDGTVFRSKDIKFNMQLIDQNDESSVFFKDCQYDKIHDLHLR 60
           MGSLP VVED GGV+QL+SDGT++RSKDI F M +I  NDES V FKDC +DK ++LHLR
Sbjct: 1   MGSLPHVVEDCGGVVQLFSDGTIYRSKDIGFPMPII--NDES-VLFKDCLFDKTYNLHLR 57

Query: 61  LYKPRSETTSSPLSKAKLPIVVFIHGGGFCAGSREWPNSHNCCFRLAAELNALVVALDYR 120
           LYKP S + SSP    KL I++++HGGGFC G+REWPN HNCC +LA+ LNALVVA DYR
Sbjct: 58  LYKPTSISLSSP--TKKLSIILYLHGGGFCVGTREWPNCHNCCLKLASGLNALVVAPDYR 115

Query: 121 LAPEHRLPAAMEDAFAAMKWLQAQALSENLNGDAWFD--EVEFDNVFVLGDSSGGNIAHH 178
           LAPEHRLPAAMED  +A++WLQAQ LS+   GDAW +  +V+++ VFVLGDSSGGNIAHH
Sbjct: 116 LAPEHRLPAAMEDGLSALQWLQAQVLSD--KGDAWVNGGKVDYEQVFVLGDSSGGNIAHH 173

Query: 179 LAVQLGGGSSELAPVRVRGYVLLAPFFGGVARTKSELGPSEAMLNLELLDSFWRLSLPIG 238
           LAVQ+G GS+ LAPVRVRGY+LLAPFFGGVARTKSE GPSE +LNLE+LD FWRLS+P G
Sbjct: 174 LAVQIGVGSTRLAPVRVRGYILLAPFFGGVARTKSEEGPSEQLLNLEILDRFWRLSMPAG 233

Query: 239 ETRDHPYANPFGPESPSLEVVSLDPMLVVASEIELLKDRAKDYAKRLKAMGKTIDFVEFK 298
            +RDHP ANPFGP S +LE+V+LDP++V+    ELL+DR +DYA+RLK MGK I++VEF+
Sbjct: 234 ASRDHPLANPFGPGSLNLELVALDPIMVIVGGCELLRDRGEDYARRLKEMGKKIEYVEFE 293

Query: 299 GQQHGFFTNEPFSEASNEFLKVVEKFMSENST 330
           G+QHGFFTN+P+SEAS E ++V++KF+ ENS+
Sbjct: 294 GKQHGFFTNDPYSEASEEVIQVMKKFVIENSS 325




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224138214|ref|XP_002322758.1| predicted protein [Populus trichocarpa] gi|222867388|gb|EEF04519.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255566245|ref|XP_002524110.1| Gibberellin receptor GID1, putative [Ricinus communis] gi|223536678|gb|EEF38320.1| Gibberellin receptor GID1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|296089309|emb|CBI39081.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225439293|ref|XP_002266241.1| PREDICTED: probable carboxylesterase 15 [Vitis vinifera] gi|147819083|emb|CAN65352.1| hypothetical protein VITISV_004582 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225439317|ref|XP_002268704.1| PREDICTED: probable carboxylesterase 15 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296089323|emb|CBI39095.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356505457|ref|XP_003521507.1| PREDICTED: probable carboxylesterase 15-like [Glycine max] Back     alignment and taxonomy information
>gi|225439319|ref|XP_002267394.1| PREDICTED: probable carboxylesterase 15 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255573281|ref|XP_002527569.1| Gibberellin receptor GID1, putative [Ricinus communis] gi|223533061|gb|EEF34821.1| Gibberellin receptor GID1, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query330
TAIR|locus:2144083329 AT5G06570 [Arabidopsis thalian 0.975 0.978 0.562 3e-94
TAIR|locus:2146097344 CXE17 "AT5G16080" [Arabidopsis 0.869 0.834 0.325 1.4e-41
TAIR|locus:2026920336 AT1G68620 [Arabidopsis thalian 0.766 0.752 0.378 7.8e-39
TAIR|locus:2174033327 CXE20 "carboxyesterase 20" [Ar 0.933 0.941 0.326 2.6e-38
TAIR|locus:2043644329 AT2G45600 [Arabidopsis thalian 0.896 0.899 0.329 5.1e-35
TAIR|locus:2099152358 GID1B "GA INSENSITIVE DWARF1B" 0.887 0.818 0.326 4.6e-34
TAIR|locus:2043654324 AT2G45610 [Arabidopsis thalian 0.827 0.842 0.310 5.2e-33
TAIR|locus:2146425344 GID1C "GA INSENSITIVE DWARF1C" 0.815 0.781 0.327 1.1e-32
TAIR|locus:2015413314 AT1G47480 [Arabidopsis thalian 0.887 0.933 0.291 2.3e-32
UNIPROTKB|Q6L545354 GID1 "Gibberellin receptor GID 0.745 0.694 0.333 2e-31
TAIR|locus:2144083 AT5G06570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 938 (335.3 bits), Expect = 3.0e-94, P = 3.0e-94
 Identities = 189/336 (56%), Positives = 235/336 (69%)

Query:     1 MGSL---PCVVEDMGGVLQLYSDGTVFRSKDIKFNMQLIDQNDESSVFFKDCQYDKIHDL 57
             MGSL   P V ED  G+LQL S+GTV RS+ I    Q I   +  +V FKD  Y K ++L
Sbjct:     1 MGSLGEEPQVAEDCMGLLQLLSNGTVLRSESIDLITQQIPFKNNQTVLFKDSIYHKPNNL 60

Query:    58 HLRLYKPRSETTSSPLSKAKLPIVVFIHGGGFCAGSREWPNSHNCCFRXXXXXXXXXXXX 117
             HLRLYKP S +     ++  LP+VVF HGGGFC GSR WP+ HN C              
Sbjct:    61 HLRLYKPISAS-----NRTALPVVVFFHGGGFCFGSRSWPHFHNFCLTLASSLNALVVSP 115

Query:   118 DYRLAPEHRLPAAMEDAFAAMKWLQAQALSENLNGDAWFDE---VEFDNVFVLGDSSGGN 174
             DYRLAPEHRLPAA EDA A + WL  QA+S+ +N   WF++   V+FD VFV+GDSSGGN
Sbjct:   116 DYRLAPEHRLPAAFEDAEAVLTWLWDQAVSDGVNH--WFEDGTDVDFDRVFVVGDSSGGN 173

Query:   175 IAHHLAVQLGGGSSELAPVRVRGYVLLAPFFGGVARTKSELGPSEAMLNLELLDSFWRLS 234
             IAH LAV+ G GS EL PVRVRGYVL+ PFFGG  RT SE GPSEA+L+L+LLD FWRLS
Sbjct:   174 IAHQLAVRFGSGSIELTPVRVRGYVLMGPFFGGEERTNSENGPSEALLSLDLLDKFWRLS 233

Query:   235 LPIGETRDHPYANPFGPESPSLEVVSLDPMLVVASEIELLKDRAKDYAKRLKAMG-KTID 293
             LP G TRDH  ANPFGP SP+LE +SL+PMLV+    ELL+DRAK+YA +LK MG K +D
Sbjct:   234 LPNGATRDHHMANPFGPTSPTLESISLEPMLVIVGGSELLRDRAKEYAYKLKKMGGKRVD 293

Query:   294 FVEFKGQQHGFFTNEPFSEASNEFLKVVEKFMSENS 329
             ++EF+ ++HGF++N P SEA+ + L+++  FM+  S
Sbjct:   294 YIEFENKEHGFYSNYPSSEAAEQVLRIIGDFMNNLS 329




GO:0005634 "nucleus" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0006865 "amino acid transport" evidence=RCA
TAIR|locus:2146097 CXE17 "AT5G16080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026920 AT1G68620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174033 CXE20 "carboxyesterase 20" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043644 AT2G45600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099152 GID1B "GA INSENSITIVE DWARF1B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043654 AT2G45610 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146425 GID1C "GA INSENSITIVE DWARF1C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015413 AT1G47480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6L545 GID1 "Gibberellin receptor GID1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FG13CXE15_ARATH3, ., 1, ., 1, ., 10.58850.96660.9696yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query330
pfam07859207 pfam07859, Abhydrolase_3, alpha/beta hydrolase fol 1e-70
COG0657312 COG0657, Aes, Esterase/lipase [Lipid metabolism] 1e-38
PRK10162318 PRK10162, PRK10162, acetyl esterase; Provisional 3e-15
pfam00135 510 pfam00135, COesterase, Carboxylesterase family 3e-09
cd00312 493 cd00312, Esterase_lipase, Esterases and lipases (i 5e-09
COG2272 491 COG2272, PnbA, Carboxylesterase type B [Lipid meta 3e-07
COG0596282 COG0596, MhpC, Predicted hydrolases or acyltransfe 5e-06
pfam12697187 pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam 7e-06
COG1506620 COG1506, DAP2, Dipeptidyl aminopeptidases/acylamin 2e-04
>gnl|CDD|219611 pfam07859, Abhydrolase_3, alpha/beta hydrolase fold Back     alignment and domain information
 Score =  217 bits (556), Expect = 1e-70
 Identities = 85/226 (37%), Positives = 121/226 (53%), Gaps = 21/226 (9%)

Query: 81  VVFIHGGGFCAGSREWPNSHNCCFRLAAELNALVVALDYRLAPEHRLPAAMEDAFAAMKW 140
           +V+ HGGGF  GS +       C RLAA   A+VV++DYRLAPEH  PAA+EDA+AA++W
Sbjct: 1   LVYFHGGGFVLGSADTH--DRLCRRLAAAAGAVVVSVDYRLAPEHPFPAAIEDAYAALRW 58

Query: 141 LQAQALSENLNGDAWFDEVEFDNVFVLGDSSGGNIAHHLAVQLGGGSSELAPVRVRGYVL 200
           L            AW    +   + V GDS+GGN+A  +A++              G VL
Sbjct: 59  LAEH---------AWELGADPSRIAVAGDSAGGNLAAAVALRARDEGL----PLPAGQVL 105

Query: 201 LAPFFGGVARTKSELGPSEA-MLNLELLDSFWRLSLPIGETRDHPYANPFGPESPSLEVV 259
           + P       ++S    ++  +L  + +D FWRL LP G  RD P A+P    +  L   
Sbjct: 106 IYPGLDLRTESESYNEYADGPLLTRDDMDWFWRLYLP-GADRDDPLASP--LFAADLS-- 160

Query: 260 SLDPMLVVASEIELLKDRAKDYAKRLKAMGKTIDFVEFKGQQHGFF 305
            L P LVV +E + L+D  + YA+RL+A G  ++ VE+ G  HGF 
Sbjct: 161 GLPPALVVVAEFDPLRDEGEAYAERLRAAGVEVELVEYPGMIHGFH 206


This catalytic domain is found in a very wide range of enzymes. Length = 207

>gnl|CDD|223730 COG0657, Aes, Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|236660 PRK10162, PRK10162, acetyl esterase; Provisional Back     alignment and domain information
>gnl|CDD|215741 pfam00135, COesterase, Carboxylesterase family Back     alignment and domain information
>gnl|CDD|238191 cd00312, Esterase_lipase, Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>gnl|CDD|225181 COG2272, PnbA, Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223669 COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|224423 COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 330
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 100.0
PRK10162318 acetyl esterase; Provisional 100.0
COG0657312 Aes Esterase/lipase [Lipid metabolism] 100.0
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 100.0
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 99.93
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 99.89
PLN02298330 hydrolase, alpha/beta fold family protein 99.87
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 99.86
PLN02385349 hydrolase; alpha/beta fold family protein 99.86
PRK10566249 esterase; Provisional 99.85
KOG1455313 consensus Lysophospholipase [Lipid transport and m 99.85
KOG4627270 consensus Kynurenine formamidase [Amino acid trans 99.85
PHA02857276 monoglyceride lipase; Provisional 99.85
PRK13604307 luxD acyl transferase; Provisional 99.84
PRK10749330 lysophospholipase L2; Provisional 99.84
PRK10115686 protease 2; Provisional 99.84
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 99.83
COG1647243 Esterase/lipase [General function prediction only] 99.83
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 99.82
COG2267298 PldB Lysophospholipase [Lipid metabolism] 99.82
PLN02442283 S-formylglutathione hydrolase 99.82
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 99.8
PRK05077414 frsA fermentation/respiration switch protein; Revi 99.8
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 99.79
PLN02652395 hydrolase; alpha/beta fold family protein 99.79
PRK11460232 putative hydrolase; Provisional 99.78
COG0412236 Dienelactone hydrolase and related enzymes [Second 99.78
PRK00870302 haloalkane dehalogenase; Provisional 99.77
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 99.77
KOG1552258 consensus Predicted alpha/beta hydrolase [General 99.76
PF00135 535 COesterase: Carboxylesterase family The prints ent 99.76
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 99.76
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 99.75
PLN02824294 hydrolase, alpha/beta fold family protein 99.74
PLN00021313 chlorophyllase 99.74
KOG4388 880 consensus Hormone-sensitive lipase HSL [Lipid tran 99.73
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 99.73
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 99.73
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 99.73
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 99.73
TIGR03611257 RutD pyrimidine utilization protein D. This protei 99.73
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 99.72
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 99.72
PRK10673255 acyl-CoA esterase; Provisional 99.71
KOG2281867 consensus Dipeptidyl aminopeptidases/acylaminoacyl 99.71
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 99.71
PLN02965255 Probable pheophorbidase 99.71
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 99.7
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 99.7
PRK10985324 putative hydrolase; Provisional 99.7
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 99.69
PLN02679360 hydrolase, alpha/beta fold family protein 99.69
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 99.69
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 99.68
PLN02511388 hydrolase 99.68
PRK03592295 haloalkane dehalogenase; Provisional 99.66
PLN02894402 hydrolase, alpha/beta fold family protein 99.66
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 99.66
PRK11071190 esterase YqiA; Provisional 99.65
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 99.65
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.65
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 99.64
PRK03204286 haloalkane dehalogenase; Provisional 99.64
PRK06489360 hypothetical protein; Provisional 99.63
COG0400207 Predicted esterase [General function prediction on 99.63
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 99.63
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 99.62
PLN02578354 hydrolase 99.62
PRK10349256 carboxylesterase BioH; Provisional 99.6
PLN02211273 methyl indole-3-acetate methyltransferase 99.6
PLN03084383 alpha/beta hydrolase fold protein; Provisional 99.6
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 99.59
PF10503220 Esterase_phd: Esterase PHB depolymerase 99.59
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 99.59
PRK07581339 hypothetical protein; Validated 99.58
COG2945210 Predicted hydrolase of the alpha/beta superfamily 99.58
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 99.55
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 99.54
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 99.52
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 99.52
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 99.52
PLN02872395 triacylglycerol lipase 99.51
KOG1838409 consensus Alpha/beta hydrolase [General function p 99.5
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 99.49
COG4099387 Predicted peptidase [General function prediction o 99.49
PRK08775343 homoserine O-acetyltransferase; Provisional 99.49
KOG4389 601 consensus Acetylcholinesterase/Butyrylcholinestera 99.48
PRK00175379 metX homoserine O-acetyltransferase; Provisional 99.48
KOG4667269 consensus Predicted esterase [Lipid transport and 99.45
KOG1516 545 consensus Carboxylesterase and related proteins [G 99.44
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 99.44
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 99.43
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 99.43
COG1505648 Serine proteases of the peptidase family S9A [Amin 99.43
KOG3101283 consensus Esterase D [General function prediction 99.4
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 99.38
PF12715390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 99.37
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 99.35
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 99.34
KOG2564343 consensus Predicted acetyltransferases and hydrola 99.33
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 99.32
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 99.31
KOG3043242 consensus Predicted hydrolase related to dienelact 99.31
KOG2382315 consensus Predicted alpha/beta hydrolase [General 99.3
KOG2237712 consensus Predicted serine protease [Posttranslati 99.28
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 99.27
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 99.27
PRK05855 582 short chain dehydrogenase; Validated 99.26
TIGR01838 532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 99.26
PRK07868 994 acyl-CoA synthetase; Validated 99.23
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 99.23
COG1770682 PtrB Protease II [Amino acid transport and metabol 99.23
KOG2112206 consensus Lysophospholipase [Lipid transport and m 99.22
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 99.22
PRK06765389 homoserine O-acetyltransferase; Provisional 99.22
PF03403379 PAF-AH_p_II: Platelet-activating factor acetylhydr 99.2
PF07224307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 99.16
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 99.13
COG0627316 Predicted esterase [General function prediction on 99.12
KOG2984277 consensus Predicted hydrolase [General function pr 99.11
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 99.11
COG2382299 Fes Enterochelin esterase and related enzymes [Ino 99.03
COG4188365 Predicted dienelactone hydrolase [General function 99.01
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 99.0
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 98.97
COG3208244 GrsT Predicted thioesterase involved in non-riboso 98.96
KOG3847399 consensus Phospholipase A2 (platelet-activating fa 98.93
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 98.89
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 98.85
PRK04940180 hypothetical protein; Provisional 98.81
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 98.76
TIGR01839 560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 98.74
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 98.74
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 98.73
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 98.72
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 98.67
COG2819264 Predicted hydrolase of the alpha/beta superfamily 98.66
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 98.63
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 98.63
KOG2624403 consensus Triglyceride lipase-cholesterol esterase 98.62
COG4814288 Uncharacterized protein with an alpha/beta hydrola 98.6
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 98.57
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 98.54
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 98.52
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 98.5
COG4757281 Predicted alpha/beta hydrolase [General function p 98.45
COG2936 563 Predicted acyl esterases [General function predict 98.42
PF12048310 DUF3530: Protein of unknown function (DUF3530); In 98.41
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 98.4
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 98.35
KOG2551230 consensus Phospholipase/carboxyhydrolase [Amino ac 98.29
KOG3253 784 consensus Predicted alpha/beta hydrolase [General 98.28
PF10142367 PhoPQ_related: PhoPQ-activated pathogenicity-relat 98.22
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 98.22
COG3150191 Predicted esterase [General function prediction on 98.21
COG2021368 MET2 Homoserine acetyltransferase [Amino acid tran 98.15
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 98.1
PF11144403 DUF2920: Protein of unknown function (DUF2920); In 98.1
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 98.06
PF05577 434 Peptidase_S28: Serine carboxypeptidase S28; InterP 98.04
KOG4840299 consensus Predicted hydrolases or acyltransferases 98.01
COG3243 445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 97.91
KOG1553517 consensus Predicted alpha/beta hydrolase BAT5 [Gen 97.91
PF02273294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 97.9
PTZ00472 462 serine carboxypeptidase (CBP1); Provisional 97.9
PF03096283 Ndr: Ndr family; InterPro: IPR004142 This family c 97.88
PF05705240 DUF829: Eukaryotic protein of unknown function (DU 97.88
COG4782377 Uncharacterized protein conserved in bacteria [Fun 97.82
PF11339 581 DUF3141: Protein of unknown function (DUF3141); In 97.82
COG3319257 Thioesterase domains of type I polyketide synthase 97.8
COG4947227 Uncharacterized protein conserved in bacteria [Fun 97.75
KOG2931326 consensus Differentiation-related gene 1 protein ( 97.72
KOG3975301 consensus Uncharacterized conserved protein [Funct 97.61
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 97.59
PLN02733 440 phosphatidylcholine-sterol O-acyltransferase 97.55
KOG2183 492 consensus Prolylcarboxypeptidase (angiotensinase C 97.45
PF07082250 DUF1350: Protein of unknown function (DUF1350); In 97.41
COG1073299 Hydrolases of the alpha/beta superfamily [General 97.29
PRK102521296 entF enterobactin synthase subunit F; Provisional 97.25
KOG3967297 consensus Uncharacterized conserved protein [Funct 97.17
PF02450 389 LCAT: Lecithin:cholesterol acyltransferase; InterP 97.11
KOG3724 973 consensus Negative regulator of COPII vesicle form 97.11
COG1075336 LipA Predicted acetyltransferases and hydrolases w 96.91
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 96.73
KOG2182 514 consensus Hydrolytic enzymes of the alpha/beta hyd 96.72
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 96.71
PF00450 415 Peptidase_S10: Serine carboxypeptidase; InterPro: 96.69
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 96.68
COG3946456 VirJ Type IV secretory pathway, VirJ component [In 96.55
PLN02209437 serine carboxypeptidase 96.49
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 96.4
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 96.36
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 96.2
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 96.2
KOG1282 454 consensus Serine carboxypeptidases (lysosomal cath 96.18
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 96.06
PLN02454414 triacylglycerol lipase 96.04
TIGR03712511 acc_sec_asp2 accessory Sec system protein Asp2. Th 95.95
PF02089279 Palm_thioest: Palmitoyl protein thioesterase; Inte 95.81
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 95.8
PF07519474 Tannase: Tannase and feruloyl esterase; InterPro: 95.66
PLN02606306 palmitoyl-protein thioesterase 95.6
PLN02633314 palmitoyl protein thioesterase family protein 95.27
PLN02571413 triacylglycerol lipase 94.74
KOG2541296 consensus Palmitoyl protein thioesterase [Lipid tr 94.66
PF03283361 PAE: Pectinacetylesterase 94.41
PLN00413479 triacylglycerol lipase 94.19
KOG1551371 consensus Uncharacterized conserved protein [Funct 94.05
PLN02408365 phospholipase A1 94.01
KOG2521350 consensus Uncharacterized conserved protein [Funct 93.86
PLN02162475 triacylglycerol lipase 93.8
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 93.79
PLN02310405 triacylglycerol lipase 93.74
COG2939 498 Carboxypeptidase C (cathepsin A) [Amino acid trans 93.33
PLN02802509 triacylglycerol lipase 92.76
PLN02934515 triacylglycerol lipase 92.74
PLN02324415 triacylglycerol lipase 92.72
PF08237225 PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum 92.6
PLN02761527 lipase class 3 family protein 92.49
PLN03037525 lipase class 3 family protein; Provisional 92.27
PLN02719518 triacylglycerol lipase 91.91
PLN02753531 triacylglycerol lipase 91.71
PF07519 474 Tannase: Tannase and feruloyl esterase; InterPro: 91.64
PLN02213319 sinapoylglucose-malate O-sinapoyltransferase/ carb 91.5
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 91.48
KOG2369 473 consensus Lecithin:cholesterol acyltransferase (LC 90.64
PLN02847 633 triacylglycerol lipase 90.45
KOG4569336 consensus Predicted lipase [Lipid transport and me 90.1
KOG4540425 consensus Putative lipase essential for disintegra 89.91
COG5153425 CVT17 Putative lipase essential for disintegration 89.91
PF04301213 DUF452: Protein of unknown function (DUF452); Inte 89.06
COG3673 423 Uncharacterized conserved protein [Function unknow 88.61
COG4287 507 PqaA PhoPQ-activated pathogenicity-related protein 88.5
KOG2565469 consensus Predicted hydrolases or acyltransferases 87.96
KOG1283 414 consensus Serine carboxypeptidases [Posttranslatio 86.16
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 84.4
PF10081289 Abhydrolase_9: Alpha/beta-hydrolase family; InterP 81.22
KOG2029697 consensus Uncharacterized conserved protein [Funct 80.6
PF05277345 DUF726: Protein of unknown function (DUF726); Inte 80.24
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
Probab=100.00  E-value=9.7e-41  Score=291.06  Aligned_cols=299  Identities=37%  Similarity=0.669  Sum_probs=257.5

Q ss_pred             ccceEEecCCceEeecCC-cccCCCCCCCCCCCceeeeeeecCCCcEEEEEEecCCCCCCCCCCCCCCcEEEEEcCCCcc
Q 020140           12 GGVLQLYSDGTVFRSKDI-KFNMQLIDQNDESSVFFKDCQYDKIHDLHLRLYKPRSETTSSPLSKAKLPIVVFIHGGGFC   90 (330)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~~~~~~~~~~~~~~p~vl~~HGgg~~   90 (330)
                      ...+....+|++.|.... +.-+|.  ..+.+++...++.+...+++.+|+|.|....     ...+.|+|||+|||||.
T Consensus        30 ~~~i~i~~~~~~~r~~~~~~~~p~~--~~p~~~v~~~dv~~~~~~~l~vRly~P~~~~-----~~~~~p~lvyfHGGGf~  102 (336)
T KOG1515|consen   30 FENIRIFKDGSFERFFGRFDKVPPS--SDPVNGVTSKDVTIDPFTNLPVRLYRPTSSS-----SETKLPVLVYFHGGGFC  102 (336)
T ss_pred             hhhceeecCCceeeeecccccCCCC--CCcccCceeeeeEecCCCCeEEEEEcCCCCC-----cccCceEEEEEeCCccE
Confidence            667888999999999886 443333  3344889999999999999999999999852     22688999999999999


Q ss_pred             CCCCCCCCcHHHHHHHHHhcCCEEEEEecccCCCCCCCchHHHHHHHHHHHHHH-hcccccCCCCccccCCCceEEEeec
Q 020140           91 AGSREWPNSHNCCFRLAAELNALVVALDYRLAPEHRLPAAMEDAFAAMKWLQAQ-ALSENLNGDAWFDEVEFDNVFVLGD  169 (330)
Q Consensus        91 ~g~~~~~~~~~~~~~~~~~~g~~v~~~dyr~~~~~~~~~~~~d~~~~~~~l~~~-~~~~~~~~~~~~~~~d~~~i~l~G~  169 (330)
                      .|+.....+..++.+++.+.++.|+++|||++|++++|..++|...++.|+.++ ...        + +.|++||+|+|.
T Consensus       103 ~~S~~~~~y~~~~~~~a~~~~~vvvSVdYRLAPEh~~Pa~y~D~~~Al~w~~~~~~~~--------~-~~D~~rv~l~GD  173 (336)
T KOG1515|consen  103 LGSANSPAYDSFCTRLAAELNCVVVSVDYRLAPEHPFPAAYDDGWAALKWVLKNSWLK--------L-GADPSRVFLAGD  173 (336)
T ss_pred             eCCCCCchhHHHHHHHHHHcCeEEEecCcccCCCCCCCccchHHHHHHHHHHHhHHHH--------h-CCCcccEEEEcc
Confidence            999887789999999999999999999999999999999999999999999996 221        3 889999999999


Q ss_pred             ChHHHHHHHHHHHhcCCCCCCCCceeceeEEeccccCCCCCCccccC---CCccccCHHHHHHHHHhcCCCCC-CCCCCC
Q 020140          170 SSGGNIAHHLAVQLGGGSSELAPVRVRGYVLLAPFFGGVARTKSELG---PSEAMLNLELLDSFWRLSLPIGE-TRDHPY  245 (330)
Q Consensus       170 S~GG~la~~~a~~~~~~~~~~~~~~v~~~vl~~p~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~  245 (330)
                      |+||++|..++.+..+..  ..+.+++|+|+++|++...+.+.++.+   ...+.......+.+|+..++.+. ..+++.
T Consensus       174 SaGGNia~~va~r~~~~~--~~~~ki~g~ili~P~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~w~~~lP~~~~~~~~p~  251 (336)
T KOG1515|consen  174 SAGGNIAHVVAQRAADEK--LSKPKIKGQILIYPFFQGTDRTESEKQQNLNGSPELARPKIDKWWRLLLPNGKTDLDHPF  251 (336)
T ss_pred             CccHHHHHHHHHHHhhcc--CCCcceEEEEEEecccCCCCCCCHHHHHhhcCCcchhHHHHHHHHHHhCCCCCCCcCCcc
Confidence            999999999999876543  246789999999999999888776555   34456677788888999999987 799999


Q ss_pred             CCCCCC-CCCCccccCCCCEEEEEeCcCcChhHHHHHHHHHHHCCCCEEEEEeCCCceeeeccCCCcHHHHHHHHHHHHH
Q 020140          246 ANPFGP-ESPSLEVVSLDPMLVVASEIELLKDRAKDYAKRLKAMGKTIDFVEFKGQQHGFFTNEPFSEASNEFLKVVEKF  324 (330)
Q Consensus       246 ~~~~~~-~~~~~~~~~~~Pvli~~G~~D~~~~~~~~~~~~l~~~g~~~~~~~~~~~~H~~~~~~~~~~~~~~~~~~i~~f  324 (330)
                      +++... ..........||+|++.++.|++.+++..|+++|+++|+++++.+++++.|+|....+..+.+.++++.+.+|
T Consensus       252 ~np~~~~~~~d~~~~~lp~tlv~~ag~D~L~D~~~~Y~~~Lkk~Gv~v~~~~~e~~~H~~~~~~~~~~~a~~~~~~i~~f  331 (336)
T KOG1515|consen  252 INPVGNSLAKDLSGLGLPPTLVVVAGYDVLRDEGLAYAEKLKKAGVEVTLIHYEDGFHGFHILDPSSKEAHALMDAIVEF  331 (336)
T ss_pred             ccccccccccCccccCCCceEEEEeCchhhhhhhHHHHHHHHHcCCeEEEEEECCCeeEEEecCCchhhHHHHHHHHHHH
Confidence            999873 3334445568899999999999999999999999999999999999999999999987788999999999999


Q ss_pred             hhhc
Q 020140          325 MSEN  328 (330)
Q Consensus       325 l~~~  328 (330)
                      +++.
T Consensus       332 i~~~  335 (336)
T KOG1515|consen  332 IKSN  335 (336)
T ss_pred             Hhhc
Confidence            9864



>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>KOG4388 consensus Hormone-sensitive lipase HSL [Lipid transport and metabolism] Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>KOG4389 consensus Acetylcholinesterase/Butyrylcholinesterase [Signal transduction mechanisms] Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1516 consensus Carboxylesterase and related proteins [General function prediction only] Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3101 consensus Esterase D [General function prediction only] Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG2237 consensus Predicted serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2112 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>KOG2984 consensus Predicted hydrolase [General function prediction only] Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG3847 consensus Phospholipase A2 (platelet-activating factor acetylhydrolase in humans) [Lipid transport and metabolism] Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3253 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF10142 PhoPQ_related: PhoPQ-activated pathogenicity-related protein; InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4840 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>KOG1553 consensus Predicted alpha/beta hydrolase BAT5 [General function prediction only] Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>PF05705 DUF829: Eukaryotic protein of unknown function (DUF829); InterPro: IPR008547 This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG4947 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown] Back     alignment and domain information
>KOG3975 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>KOG3967 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>KOG2182 consensus Hydrolytic enzymes of the alpha/beta hydrolase fold [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>TIGR03712 acc_sec_asp2 accessory Sec system protein Asp2 Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>PLN02606 palmitoyl-protein thioesterase Back     alignment and domain information
>PLN02633 palmitoyl protein thioesterase family protein Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>KOG2541 consensus Palmitoyl protein thioesterase [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03283 PAE: Pectinacetylesterase Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>KOG1551 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>KOG2521 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information
>KOG4569 consensus Predicted lipase [Lipid transport and metabolism] Back     alignment and domain information
>KOG4540 consensus Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking, secretion, and vesicular transport; Lipid transport and metabolism] Back     alignment and domain information
>COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] Back     alignment and domain information
>PF04301 DUF452: Protein of unknown function (DUF452); InterPro: IPR007398 This is a family of uncharacterised proteins Back     alignment and domain information
>COG3673 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4287 PqaA PhoPQ-activated pathogenicity-related protein [General function prediction only] Back     alignment and domain information
>KOG2565 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG1283 consensus Serine carboxypeptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>PF10081 Abhydrolase_9: Alpha/beta-hydrolase family; InterPro: IPR012037 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2029 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query330
2o7r_A338 Plant Carboxylesterase Aecxe1 From Actinidia Eriant 3e-42
3ebl_A365 Crystal Structure Of Rice Gid1 Complexed With Ga4 L 5e-32
2zsh_A351 Structural Basis Of Gibberellin(Ga3)-Induced Della 6e-32
2yh2_A313 Pyrobaculum Calidifontis Esterase Monoclinic Form L 6e-24
2c7b_A311 The Crystal Structure Of Este1, A New Thermophilic 4e-23
1jji_A311 The Crystal Structure Of A Hyper-Thermophilic Carbo 9e-21
3aim_A323 R267e Mutant Of A Hsl-Like Carboxylesterase From Su 2e-17
3aio_A323 R267k Mutant Of A Hsl-Like Carboxylesterase From Su 5e-17
3aik_A323 Crystal Structure Of A Hsl-Like Carboxylesterase Fr 7e-17
3ain_A323 R267g Mutant Of A Hsl-Like Carboxylesterase From Su 9e-17
1qz3_A310 Crystal Structure Of Mutant M211sR215L OF CARBOXYLE 6e-14
2hm7_A310 Crystal Structure Analysis Of The G84s Est2 Mutant 6e-13
1evq_A310 The Crystal Structure Of The Thermophilic Carboxyle 6e-13
1lzk_A323 Bacterial Heroin Esterase Complex With Transition S 2e-10
1lzl_A323 Bacterial Heroin Esterase Length = 323 3e-10
3qh4_A317 Crystal Structure Of Esterase Lipw From Mycobacteri 2e-09
3k6k_A322 Crystal Structure At 2.2 Angstrom Of Hsl-Homolog Es 2e-08
3dnm_A336 Crystal Structure Hormone-Sensitive Lipase From A M 2e-08
3v9a_A309 Crystal Structure Of EsteraseLIPASE FROM UNCULTURED 5e-08
3fak_A322 Structural And Functional Analysis Of A Hormone-Sen 7e-08
1jkm_B361 Brefeldin A Esterase, A Bacterial Homologue Of Huma 1e-04
>pdb|2O7R|A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct Length = 338 Back     alignment and structure

Iteration: 1

Score = 169 bits (427), Expect = 3e-42, Method: Compositional matrix adjust. Identities = 109/325 (33%), Positives = 162/325 (49%), Gaps = 25/325 (7%) Query: 15 LQLYSDGTVFRSKDIKFNMQLIDQNDESSVFFKDCQYDKIHDLHLRLYKPRSETTSSPLS 74 + L D T+ R I D S V KD + +H+ +RL+ PR +S Sbjct: 24 IVLNPDRTITRPIQIPSTAASPDPTSSSPVLTKDLALNPLHNTFVRLFLPRHALYNS--- 80 Query: 75 KAKLPIVVFIHGGGFCAGSREWPNSHNCCFRXXXXXXXXXXXXDYRLAPEHRLPAAMEDA 134 AKLP+VV+ HGGGF S H+ C DYRLAPEHRLPAA +DA Sbjct: 81 -AKLPLVVYFHGGGFILFSAASTIFHDFCCEMAVHAGVVIASVDYRLAPEHRLPAAYDDA 139 Query: 135 FAAMKWLQAQALSENLNGDAWFDE-VEFDNVFVLGDSSGGNIAHHLAVQLGGGSSELAPV 193 A++W++ + D W +F N F++G+S+GGNIA+H ++ + EL P+ Sbjct: 140 MEALQWIKD-------SRDEWLTNFADFSNCFIMGESAGGNIAYHAGLRAAAVADELLPL 192 Query: 194 RVRGYVLLAPFFGGVARTKSELG-PSEAMLNLELLDSFWRLSLPIGETRDHPYANPFGPE 252 +++G VL P FGG RT SEL +++ L +LD W LSLP+G RDH Y NP Sbjct: 193 KIKGLVLDEPGFGGSKRTGSELRLANDSRLPTFVLDLIWELSLPMGADRDHEYCNPTAES 252 Query: 253 SPSLEVVSLDPM-------LVVASEIELLKDRAKDYAKRLKAMGKTIDFVEFKGQQHGFF 305 P + S D + +VV + + DR + A+RL+ G + G H Sbjct: 253 EP---LYSFDKIRSLGWRVMVVGCHGDPMIDRQMELAERLEKKGVDVVAQFDVGGYHAVK 309 Query: 306 TNEPFSEASNEFLKVVEKFMSENST 330 +P E + +F +++KF+ ++ T Sbjct: 310 LEDP--EKAKQFFVILKKFVVDSCT 332
>pdb|3EBL|A Chain A, Crystal Structure Of Rice Gid1 Complexed With Ga4 Length = 365 Back     alignment and structure
>pdb|2ZSH|A Chain A, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor Length = 351 Back     alignment and structure
>pdb|2YH2|A Chain A, Pyrobaculum Calidifontis Esterase Monoclinic Form Length = 313 Back     alignment and structure
>pdb|2C7B|A Chain A, The Crystal Structure Of Este1, A New Thermophilic And Thermostable Carboxylesterase Cloned From A Metagenomic Library Length = 311 Back     alignment and structure
>pdb|1JJI|A Chain A, The Crystal Structure Of A Hyper-Thermophilic Carboxylesterase From The Archaeon Archaeoglobus Fulgidus Length = 311 Back     alignment and structure
>pdb|3AIM|A Chain A, R267e Mutant Of A Hsl-Like Carboxylesterase From Sulfolobus Tokodaii Length = 323 Back     alignment and structure
>pdb|3AIO|A Chain A, R267k Mutant Of A Hsl-Like Carboxylesterase From Sulfolobus Tokodaii Length = 323 Back     alignment and structure
>pdb|3AIK|A Chain A, Crystal Structure Of A Hsl-Like Carboxylesterase From Sulfolobus Tokodaii Length = 323 Back     alignment and structure
>pdb|3AIN|A Chain A, R267g Mutant Of A Hsl-Like Carboxylesterase From Sulfolobus Tokodaii Length = 323 Back     alignment and structure
>pdb|1QZ3|A Chain A, Crystal Structure Of Mutant M211sR215L OF CARBOXYLESTERASE Est2 Complexed With Hexadecanesulfonate Length = 310 Back     alignment and structure
>pdb|2HM7|A Chain A, Crystal Structure Analysis Of The G84s Est2 Mutant Length = 310 Back     alignment and structure
>pdb|1EVQ|A Chain A, The Crystal Structure Of The Thermophilic Carboxylesterase Est2 From Alicyclobacillus Acidocaldarius Length = 310 Back     alignment and structure
>pdb|1LZK|A Chain A, Bacterial Heroin Esterase Complex With Transition State Analog Dimethylarsenic Acid Length = 323 Back     alignment and structure
>pdb|1LZL|A Chain A, Bacterial Heroin Esterase Length = 323 Back     alignment and structure
>pdb|3QH4|A Chain A, Crystal Structure Of Esterase Lipw From Mycobacterium Marinum Length = 317 Back     alignment and structure
>pdb|3K6K|A Chain A, Crystal Structure At 2.2 Angstrom Of Hsl-Homolog Este7 From A Metagenome Library Length = 322 Back     alignment and structure
>pdb|3DNM|A Chain A, Crystal Structure Hormone-Sensitive Lipase From A Metagenome Library Length = 336 Back     alignment and structure
>pdb|3V9A|A Chain A, Crystal Structure Of EsteraseLIPASE FROM UNCULTURED BACTERIUM Length = 309 Back     alignment and structure
>pdb|3FAK|A Chain A, Structural And Functional Analysis Of A Hormone-Sensitive Lipase Like Este5 From A Metagenome Library Length = 322 Back     alignment and structure
>pdb|1JKM|B Chain B, Brefeldin A Esterase, A Bacterial Homologue Of Human Hormone Sensitive Lipase Length = 361 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query330
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 1e-116
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 1e-110
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 1e-109
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 2e-51
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 3e-50
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 2e-49
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 3e-49
3ain_A323 303AA long hypothetical esterase; carboxylesterase 3e-49
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 2e-48
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 3e-47
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 3e-46
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 3e-46
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 2e-44
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 6e-44
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 1e-41
3h04_A275 Uncharacterized protein; protein with unknown func 5e-41
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 6e-40
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 1e-26
1vkh_A273 Putative serine hydrolase; structural genomics, jo 2e-26
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 2e-20
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 3e-19
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 3e-18
3bjr_A283 Putative carboxylesterase; structural genomics, jo 9e-18
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 5e-10
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 1e-09
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 3e-09
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 4e-09
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 1e-08
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 2e-08
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 3e-08
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 3e-08
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 5e-08
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 6e-08
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 8e-08
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 1e-07
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 1e-07
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 1e-07
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 3e-07
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 1e-06
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 1e-06
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 3e-06
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 5e-06
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 6e-06
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 6e-06
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 8e-06
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 2e-05
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 4e-05
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 4e-05
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 7e-05
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 9e-05
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 1e-04
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 3e-04
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 5e-04
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 6e-04
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 6e-04
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 6e-04
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 6e-04
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 6e-04
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 6e-04
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 7e-04
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 8e-04
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 8e-04
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 9e-04
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Length = 338 Back     alignment and structure
 Score =  337 bits (866), Expect = e-116
 Identities = 109/332 (32%), Positives = 164/332 (49%), Gaps = 19/332 (5%)

Query: 5   PCVVEDMGGVLQLYSDGTVFRSKDIKFNMQLIDQNDESSVFFKDCQYDKIHDLHLRLYKP 64
           P         + L  D T+ R   I       D    S V  KD   + +H+  +RL+ P
Sbjct: 14  PNTNLLKYLPIVLNPDRTITRPIQIPSTAASPDPTSSSPVLTKDLALNPLHNTFVRLFLP 73

Query: 65  RSETTSSPLSKAKLPIVVFIHGGGFCAGSREWPNSHNCCFRLAAELNALVVALDYRLAPE 124
           R    +S    AKLP+VV+ HGGGF   S      H+ C  +A     ++ ++DYRLAPE
Sbjct: 74  RHALYNS----AKLPLVVYFHGGGFILFSAASTIFHDFCCEMAVHAGVVIASVDYRLAPE 129

Query: 125 HRLPAAMEDAFAAMKWLQAQALSENLNGDAWFDE-VEFDNVFVLGDSSGGNIAHHLAVQL 183
           HRLPAA +DA  A++W++          D W     +F N F++G+S+GGNIA+H  ++ 
Sbjct: 130 HRLPAAYDDAMEALQWIKDSR-------DEWLTNFADFSNCFIMGESAGGNIAYHAGLRA 182

Query: 184 GGGSSELAPVRVRGYVLLAPFFGGVARTKSELGPSEA-MLNLELLDSFWRLSLPIGETRD 242
              + EL P++++G VL  P FGG  RT SEL  +    L   +LD  W LSLP+G  RD
Sbjct: 183 AAVADELLPLKIKGLVLDEPGFGGSKRTGSELRLANDSRLPTFVLDLIWELSLPMGADRD 242

Query: 243 HPYANPFGPESPSLEVVSLD----PMLVVASEIELLKDRAKDYAKRLKAMGKTIDFVEFK 298
           H Y NP     P      +      ++VV    + + DR  + A+RL+  G  +      
Sbjct: 243 HEYCNPTAESEPLYSFDKIRSLGWRVMVVGCHGDPMIDRQMELAERLEKKGVDVVAQFDV 302

Query: 299 GQQHGFFTNEPFSEASNEFLKVVEKFMSENST 330
           G  H     +P  E + +F  +++KF+ ++ T
Sbjct: 303 GGYHAVKLEDP--EKAKQFFVILKKFVVDSCT 332


>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Length = 351 Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Length = 365 Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Length = 326 Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Length = 311 Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Length = 310 Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Length = 323 Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Length = 311 Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Length = 317 Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Length = 322 Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Length = 322 Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Length = 323 Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Length = 361 Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Length = 274 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Length = 275 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Length = 326 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Length = 303 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Length = 273 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Length = 277 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Length = 262 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Length = 276 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Length = 283 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Length = 290 Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Length = 574 Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Length = 542 Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Length = 534 Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Length = 579 Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Length = 551 Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Length = 522 Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Length = 543 Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Length = 537 Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Length = 529 Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Length = 498 Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Length = 544 Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Length = 258 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Length = 582 Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Length = 489 Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Length = 585 Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Length = 210 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Length = 251 Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Length = 422 Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Length = 270 Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Length = 306 Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Length = 446 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Length = 262 Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Length = 380 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Length = 305 Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Length = 316 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Length = 286 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Length = 662 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Length = 223 Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Length = 415 Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Length = 386 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Length = 289 Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Length = 286 Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Length = 398 Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Length = 259 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Length = 291 Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Length = 241 Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Length = 285 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Length = 306 Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Length = 272 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query330
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 100.0
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 100.0
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 100.0
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 100.0
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 100.0
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 100.0
3ain_A323 303AA long hypothetical esterase; carboxylesterase 100.0
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 100.0
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 100.0
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 100.0
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 100.0
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 100.0
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 100.0
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 99.98
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 99.97
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 99.97
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 99.97
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 99.96
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 99.96
3bjr_A283 Putative carboxylesterase; structural genomics, jo 99.95
1vkh_A273 Putative serine hydrolase; structural genomics, jo 99.93
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 99.93
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 99.92
3h04_A275 Uncharacterized protein; protein with unknown func 99.92
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 99.92
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.92
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 99.91
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.91
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 99.91
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.9
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.9
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.9
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.9
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 99.9
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 99.9
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.89
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 99.89
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 99.89
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 99.89
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.89
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 99.89
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 99.89
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 99.89
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.89
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 99.89
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.89
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.89
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 99.89
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 99.88
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 99.88
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 99.88
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 99.88
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 99.88
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 99.88
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 99.88
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 99.88
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 99.88
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 99.87
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 99.87
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 99.87
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 99.87
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 99.87
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 99.86
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 99.86
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 99.86
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 99.86
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 99.86
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 99.86
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 99.85
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 99.85
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 99.85
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 99.85
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 99.85
3llc_A270 Putative hydrolase; structural genomics, joint cen 99.85
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 99.84
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 99.84
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 99.84
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 99.84
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 99.84
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 99.84
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 99.83
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 99.83
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 99.83
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 99.83
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 99.83
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 99.83
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 99.83
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 99.83
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 99.83
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 99.83
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 99.82
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 99.82
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 99.82
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 99.81
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 99.81
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 99.81
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 99.81
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 99.81
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 99.81
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 99.81
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 99.81
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 99.81
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 99.81
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 99.8
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.8
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 99.8
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 99.8
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 99.8
4f21_A246 Carboxylesterase/phospholipase family protein; str 99.8
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 99.8
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 99.8
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 99.79
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 99.79
3d59_A383 Platelet-activating factor acetylhydrolase; secret 99.79
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 99.79
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 99.78
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 99.78
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 99.78
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 99.78
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 99.78
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 99.78
4fle_A202 Esterase; structural genomics, PSI-biology, northe 99.78
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 99.78
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 99.77
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 99.77
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 99.77
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 99.77
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 99.77
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 99.77
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.77
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 99.77
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 99.77
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 99.77
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 99.77
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 99.76
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 99.76
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 99.76
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 99.76
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 99.76
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 99.76
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 99.76
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 99.76
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.76
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 99.76
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 99.75
1iup_A282 META-cleavage product hydrolase; aromatic compound 99.75
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 99.75
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 99.75
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 99.75
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 99.75
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 99.75
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 99.75
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 99.74
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 99.74
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 99.74
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 99.74
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 99.74
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 99.74
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 99.74
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 99.74
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 99.74
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 99.74
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 99.74
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 99.74
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 99.73
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 99.73
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 99.73
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 99.73
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 99.73
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 99.73
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 99.72
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 99.72
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 99.72
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 99.72
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 99.72
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 99.72
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 99.72
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 99.72
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 99.71
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 99.71
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 99.71
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 99.71
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 99.7
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 99.7
3nuz_A398 Putative acetyl xylan esterase; structural genomic 99.7
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 99.69
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 99.69
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 99.69
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 99.69
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 99.69
1r3d_A264 Conserved hypothetical protein VC1974; structural 99.69
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 99.68
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 99.68
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 99.68
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 99.67
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 99.66
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 99.65
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 99.47
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 99.64
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 99.63
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 99.63
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 99.61
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 99.61
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 99.61
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 99.6
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 99.58
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 99.57
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 99.57
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 99.56
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 99.54
3lp5_A250 Putative cell surface hydrolase; structural genom 99.52
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 99.52
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 99.5
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 99.46
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 99.44
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 99.44
1kez_A300 Erythronolide synthase; polyketide synthase, modul 99.42
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 99.4
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 99.36
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 99.33
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 99.32
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 99.29
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 99.27
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 99.26
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 99.24
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 99.24
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 99.23
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 99.21
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 99.19
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 99.18
4g4g_A433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 99.15
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 99.13
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 99.13
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 99.1
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 99.08
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 99.07
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 99.03
3tej_A329 Enterobactin synthase component F; nonribosomal pe 98.98
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 98.92
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 98.65
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 98.62
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 98.58
2dsn_A387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 98.57
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 98.49
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 98.27
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 98.03
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 97.89
4ebb_A 472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 97.89
1ivy_A 452 Human protective protein; carboxypeptidase, serine 97.85
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 97.26
4az3_A300 Lysosomal protective protein 32 kDa chain; hydrola 97.19
1ac5_A 483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 97.1
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 97.1
1cpy_A 421 Serine carboxypeptidase; hydrolase (carboxypeptida 97.08
3hc7_A254 Gene 12 protein, GP12; alpha/beta sandwich, cell a 96.69
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 96.6
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 96.38
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 96.31
3aja_A302 Putative uncharacterized protein; alpha-beta hydro 96.15
2czq_A205 Cutinase-like protein; alpha/beta hydrolase fold, 96.15
3qpa_A197 Cutinase; alpha-beta hydrolase fold, esterase, hyd 95.89
1g66_A207 Acetyl xylan esterase II; serine hydrolase, acetyl 95.8
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 95.59
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 95.55
1qoz_A207 AXE, acetyl xylan esterase; hydrolase, xylan degra 95.52
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 94.93
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 94.82
3dcn_A201 Cutinase, cutin hydrolase; catalytic triad, secret 94.77
2vsq_A1304 Surfactin synthetase subunit 3; ligase, peptidyl c 93.69
3qpd_A187 Cutinase 1; alpha-beta hydrolase fold, esterase, h 92.74
2d81_A318 PHB depolymerase; alpha/beta hydrolase fold, circu 90.88
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 90.87
2vz8_A2512 Fatty acid synthase; transferase, phosphopantethei 89.76
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 85.48
2yij_A419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 83.25
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
Probab=100.00  E-value=6.3e-39  Score=289.64  Aligned_cols=299  Identities=31%  Similarity=0.534  Sum_probs=233.9

Q ss_pred             EecCCceEeecCCccc-CCCCCCCCCCCceeeeeeecCCCcEEEEEEe-cCCCCCC---------------CCCCCCCCc
Q 020140           17 LYSDGTVFRSKDIKFN-MQLIDQNDESSVFFKDCQYDKIHDLHLRLYK-PRSETTS---------------SPLSKAKLP   79 (330)
Q Consensus        17 ~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-P~~~~~~---------------~~~~~~~~p   79 (330)
                      ..++|++.|.....+. ..+....+..++..+++.+++.+++.+++|. |......               .....++.|
T Consensus        34 ~~~dg~v~r~~~~~~~~~~~~~~~~~~~v~~~dv~~~~~~gl~~~~~~~P~~~~~~~~~~~~~~~~l~~~~~~~~~~~~P  113 (365)
T 3ebl_A           34 RRADGTFERDLGEYLDRRVPANARPLEGVSSFDHIIDQSVGLEVRIYRAAAEGDAEEGAAAVTRPILEFLTDAPAAEPFP  113 (365)
T ss_dssp             BCTTSCBCHHHHHHHSCBCCCCSSCBTTEEEEEEEEETTTTEEEEEEEEC----------------CGGGGSCCBSSCCE
T ss_pred             cCCCCceEecCcccccCCCCCCCCCCCCCceeeEEecCCCCceEEEEeCCCccccccccccccccccccccCCCCCCcce
Confidence            4578999988653221 1111233457899999999999999999998 8752000               000235789


Q ss_pred             EEEEEcCCCccCCCCCCCCcHHHHHHHHHhcCCEEEEEecccCCCCCCCchHHHHHHHHHHHHHHhcccccCCCCccccC
Q 020140           80 IVVFIHGGGFCAGSREWPNSHNCCFRLAAELNALVVALDYRLAPEHRLPAAMEDAFAAMKWLQAQALSENLNGDAWFDEV  159 (330)
Q Consensus        80 ~vl~~HGgg~~~g~~~~~~~~~~~~~~~~~~g~~v~~~dyr~~~~~~~~~~~~d~~~~~~~l~~~~~~~~~~~~~~~~~~  159 (330)
                      +|||+|||||..|+.....+..++..++.+.||.|+++|||++++..++..++|+.++++|+.+....      . + ++
T Consensus       114 vvv~~HGGg~~~g~~~~~~~~~~~~~la~~~g~~Vv~~dyR~~p~~~~~~~~~D~~~a~~~l~~~~~~------~-~-~~  185 (365)
T 3ebl_A          114 VIIFFHGGSFVHSSASSTIYDSLCRRFVKLSKGVVVSVNYRRAPEHRYPCAYDDGWTALKWVMSQPFM------R-S-GG  185 (365)
T ss_dssp             EEEEECCSTTTSCCTTBHHHHHHHHHHHHHHTSEEEEECCCCTTTSCTTHHHHHHHHHHHHHHHCTTT------E-E-TT
T ss_pred             EEEEEcCCccccCCCchhhHHHHHHHHHHHCCCEEEEeeCCCCCCCCCcHHHHHHHHHHHHHHhCchh------h-h-CC
Confidence            99999999999988765445677788888789999999999999999999999999999999964310      0 2 67


Q ss_pred             CCc-eEEEeecChHHHHHHHHHHHhcCCCCCCCCceeceeEEeccccCCCCCCccccC-CCccccCHHHHHHHHHhcCCC
Q 020140          160 EFD-NVFVLGDSSGGNIAHHLAVQLGGGSSELAPVRVRGYVLLAPFFGGVARTKSELG-PSEAMLNLELLDSFWRLSLPI  237 (330)
Q Consensus       160 d~~-~i~l~G~S~GG~la~~~a~~~~~~~~~~~~~~v~~~vl~~p~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~  237 (330)
                      |++ +|+|+|+|+||++|+.++.+..+..     .+++++|+++|+++......+... ....++.......+|..+.+.
T Consensus       186 d~~~ri~l~G~S~GG~la~~~a~~~~~~~-----~~~~g~vl~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  260 (365)
T 3ebl_A          186 DAQARVFLSGDSSGGNIAHHVAVRAADEG-----VKVCGNILLNAMFGGTERTESERRLDGKYFVTLQDRDWYWKAYLPE  260 (365)
T ss_dssp             TTEEEEEEEEETHHHHHHHHHHHHHHHTT-----CCCCEEEEESCCCCCSSCCHHHHHHTTTSSCCHHHHHHHHHHHSCT
T ss_pred             CCCCcEEEEeeCccHHHHHHHHHHHHhcC-----CceeeEEEEccccCCCcCChhhhhcCCCcccCHHHHHHHHHHhCCC
Confidence            888 9999999999999999998864421     469999999999987766555444 446677788888999999887


Q ss_pred             CCCCCCCCCCCCCCCCCCccccCCCCEEEEEeCcCcChhHHHHHHHHHHHCCCCEEEEEeCCCceeeeccCCCcHHHHHH
Q 020140          238 GETRDHPYANPFGPESPSLEVVSLDPMLVVASEIELLKDRAKDYAKRLKAMGKTIDFVEFKGQQHGFFTNEPFSEASNEF  317 (330)
Q Consensus       238 ~~~~~~~~~~~~~~~~~~~~~~~~~Pvli~~G~~D~~~~~~~~~~~~l~~~g~~~~~~~~~~~~H~~~~~~~~~~~~~~~  317 (330)
                      .....++..+++......+.....+|+||+||+.|++.+++..++++|+++|+++++++|+|++|+|... +..++..++
T Consensus       261 ~~~~~~~~~~p~~~~~~~l~~~~~pP~Li~~G~~D~l~~~~~~~~~~L~~~g~~v~l~~~~g~~H~f~~~-~~~~~~~~~  339 (365)
T 3ebl_A          261 DADRDHPACNPFGPNGRRLGGLPFAKSLIIVSGLDLTCDRQLAYADALREDGHHVKVVQCENATVGFYLL-PNTVHYHEV  339 (365)
T ss_dssp             TCCTTSTTTCTTSTTCCCCTTSCCCCEEEEEETTSTTHHHHHHHHHHHHHTTCCEEEEEETTCCTTGGGS-SCSHHHHHH
T ss_pred             CCCCCCcccCCCCCcchhhccCCCCCEEEEEcCcccchhHHHHHHHHHHHCCCCEEEEEECCCcEEEecc-CCCHHHHHH
Confidence            7777777777765444444433468999999999988889999999999999999999999999998875 456889999


Q ss_pred             HHHHHHHhhhcC
Q 020140          318 LKVVEKFMSENS  329 (330)
Q Consensus       318 ~~~i~~fl~~~~  329 (330)
                      ++.+.+||+++.
T Consensus       340 ~~~i~~Fl~~~~  351 (365)
T 3ebl_A          340 MEEISDFLNANL  351 (365)
T ss_dssp             HHHHHHHHHHHC
T ss_pred             HHHHHHHHHHhh
Confidence            999999998764



>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis} Back     alignment and structure
>2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} Back     alignment and structure
>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 330
d1jjia_311 c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeogl 2e-27
d1jkma_358 c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, 6e-25
d1lzla_317 c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [Ta 3e-19
d1u4na_308 c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus a 7e-19
d1vkha_263 c.69.1.32 (A:) Putative serine hydrolase Ydr428c { 9e-18
d2pbla1261 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_ 1e-10
d1xfda2258 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-li 2e-10
d2bcea_ 579 c.69.1.1 (A:) Bile-salt activated lipase (choleste 5e-10
d1thga_ 544 c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fun 1e-07
d1llfa_ 534 c.69.1.17 (A:) Type-B carboxylesterase/lipase {Can 6e-07
d2bgra2258 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26 3e-06
d1ukca_ 517 c.69.1.17 (A:) Esterase EstA {Aspergillus niger [T 1e-05
d1thta_302 c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase 2e-04
d1tcaa_317 c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Cand 2e-04
d1qlwa_318 c.69.1.15 (A:) A novel bacterial esterase {Alcalig 4e-04
d2hu7a2260 c.69.1.33 (A:322-581) Acylamino-acid-releasing enz 5e-04
d1dx4a_ 571 c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Dro 0.001
d1qfma2280 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-term 0.001
d2d81a1 318 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymer 0.002
d2gzsa1265 c.69.1.38 (A:41-305) Enterobactin and salmochelin 0.002
d1k8qa_377 c.69.1.6 (A:) Gastric lipase {Dog (Canis familiari 0.002
d1sfra_288 c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculo 0.003
d1cvla_319 c.69.1.18 (A:) Lipase {Chromobacterium viscosum [T 0.004
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 311 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Carboxylesterase
domain: Carboxylesterase
species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]
 Score =  107 bits (266), Expect = 2e-27
 Identities = 71/270 (26%), Positives = 123/270 (45%), Gaps = 28/270 (10%)

Query: 56  DLHLRLYKPRSETTSSPLSKAKLPIVVFIHGGGFCAGSREWPNSHNCCFRLAAELNALVV 115
           D+ +R+Y+           K   P++V+ HGGGF   S E       C R+A   N+ VV
Sbjct: 67  DIRVRVYQQ----------KPDSPVLVYYHGGGFVICSIESH--DALCRRIARLSNSTVV 114

Query: 116 ALDYRLAPEHRLPAAMEDAFAAMKWLQAQALSENLNGDAWFDEVEFDNVFVLGDSSGGNI 175
           ++DYRLAPEH+ PAA+ D + A KW+   A  E L  D          +FV GDS+GGN+
Sbjct: 115 SVDYRLAPEHKFPAAVYDCYDATKWVAENA--EELRIDP-------SKIFVGGDSAGGNL 165

Query: 176 AHHLAVQLGGGSSELAPVRVRGYVLLAPFFGGVARTKSELGPSEAMLNLELLDSFWRLSL 235
           A  +++       +    ++  Y      F     +  E G    +L+ +++  F     
Sbjct: 166 AAAVSIMARDSGEDFIKHQILIYP--VVNFVAPTPSLLEFGEGLWILDQKIMSWFSEQYF 223

Query: 236 PIGETRDHPYANPFGPESPSLEVVSLDPMLVVASEIELLKDRAKDYAKRLKAMGKTIDFV 295
              E + +P A+    +  +L      P L++ +E + L+D  + + + L+  G     V
Sbjct: 224 SREEDKFNPLASVIFADLENL-----PPALIITAEYDPLRDEGEVFGQMLRRAGVEASIV 278

Query: 296 EFKGQQHGFFTNEPFSEASNEFLKVVEKFM 325
            ++G  HGF    P  +A+ + +  +   +
Sbjct: 279 RYRGVLHGFINYYPVLKAARDAINQIAALL 308


>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Length = 358 Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Length = 317 Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Length = 308 Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 263 Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Length = 261 Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Length = 579 Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Length = 544 Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Length = 534 Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 258 Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Length = 517 Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Length = 302 Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Length = 317 Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Length = 318 Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Length = 260 Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 571 Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 280 Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Length = 318 Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Length = 265 Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Length = 377 Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Length = 288 Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Length = 319 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query330
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 100.0
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 100.0
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 100.0
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 100.0
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 99.95
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 99.95
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 99.95
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 99.95
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 99.92
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 99.9
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 99.89
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 99.88
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 99.86
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 99.86
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 99.86
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 99.85
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 99.84
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 99.84
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 99.84
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 99.84
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 99.82
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 99.82
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 99.81
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 99.81
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 99.81
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 99.81
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 99.81
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 99.81
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 99.81
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.8
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.8
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 99.8
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 99.8
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 99.79
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 99.79
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 99.79
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 99.79
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 99.79
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 99.79
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 99.78
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 99.78
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.78
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 99.78
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 99.77
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 99.77
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 99.77
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 99.77
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 99.76
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 99.76
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 99.76
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 99.75
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 99.75
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 99.74
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.74
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 99.73
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 99.73
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 99.72
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 99.72
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 99.71
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 99.7
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 99.7
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 99.7
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 99.7
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 99.62
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 99.61
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 99.61
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 99.6
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 99.59
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 99.55
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 99.53
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 99.52
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 99.49
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 99.46
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 99.44
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 99.44
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 99.43
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 99.42
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 99.3
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 99.29
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 99.18
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 99.11
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 99.1
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 99.1
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 99.07
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 99.01
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 98.96
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 98.96
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 98.95
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 98.88
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 98.78
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 98.77
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 98.47
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 97.76
d1ku0a_388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 97.61
d1ivya_ 452 Human 'protective protein', HPP {Human (Homo sapie 96.81
d1wpxa1 421 Serine carboxypeptidase II {Baker's yeast (Sacchar 96.6
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 96.57
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 96.26
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 95.98
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 95.8
d1ac5a_ 483 Serine carboxypeptidase II {Baker's yeast (Sacchar 95.78
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 95.64
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 94.92
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 93.62
d1g66a_207 Acetylxylan esterase {Penicillium purpurogenum [Ta 90.08
g1gxs.1425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 89.98
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Carboxylesterase
domain: Carboxylesterase
species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]
Probab=100.00  E-value=8.5e-37  Score=267.79  Aligned_cols=253  Identities=28%  Similarity=0.493  Sum_probs=206.9

Q ss_pred             ceeeeeeecCCC-cEEEEEEecCCCCCCCCCCCCCCcEEEEEcCCCccCCCCCCCCcHHHHHHHHHhcCCEEEEEecccC
Q 020140           44 VFFKDCQYDKIH-DLHLRLYKPRSETTSSPLSKAKLPIVVFIHGGGFCAGSREWPNSHNCCFRLAAELNALVVALDYRLA  122 (330)
Q Consensus        44 ~~~~~~~~~~~~-~~~~~~~~P~~~~~~~~~~~~~~p~vl~~HGgg~~~g~~~~~~~~~~~~~~~~~~g~~v~~~dyr~~  122 (330)
                      ...+++.+...+ .+.+++|.|++          +.|+|||+|||||..|+...  +..++..++.+.|+.|+++|||++
T Consensus        54 ~~~~~~~i~~~~g~i~~~iy~P~~----------~~P~il~iHGGg~~~g~~~~--~~~~~~~l~~~~g~~Vv~v~Yrla  121 (311)
T d1jjia_          54 ERVEDRTIKGRNGDIRVRVYQQKP----------DSPVLVYYHGGGFVICSIES--HDALCRRIARLSNSTVVSVDYRLA  121 (311)
T ss_dssp             SEEEEEEEEETTEEEEEEEEESSS----------SEEEEEEECCSTTTSCCTGG--GHHHHHHHHHHHTSEEEEEECCCT
T ss_pred             ceEEEEEEeCCCCcEEEEEEcCCC----------CceEEEEEcCCCCccCChhh--hhhhhhhhhhcCCcEEEEeccccc
Confidence            345666665433 59999999865          45999999999999999875  777888898888999999999999


Q ss_pred             CCCCCCchHHHHHHHHHHHHHHhcccccCCCCccccCCCceEEEeecChHHHHHHHHHHHhcCCCCCCCCceeceeEEec
Q 020140          123 PEHRLPAAMEDAFAAMKWLQAQALSENLNGDAWFDEVEFDNVFVLGDSSGGNIAHHLAVQLGGGSSELAPVRVRGYVLLA  202 (330)
Q Consensus       123 ~~~~~~~~~~d~~~~~~~l~~~~~~~~~~~~~~~~~~d~~~i~l~G~S~GG~la~~~a~~~~~~~~~~~~~~v~~~vl~~  202 (330)
                      +++.++..++|+.++++|+.++.++        + ++|++||+|+|+|+||++++.++....+..    ...+.++++++
T Consensus       122 p~~~~p~~~~d~~~a~~~~~~~~~~--------~-~~d~~ri~v~G~SaGG~la~~~~~~~~~~~----~~~~~~~~l~~  188 (311)
T d1jjia_         122 PEHKFPAAVYDCYDATKWVAENAEE--------L-RIDPSKIFVGGDSAGGNLAAAVSIMARDSG----EDFIKHQILIY  188 (311)
T ss_dssp             TTSCTTHHHHHHHHHHHHHHHTHHH--------H-TEEEEEEEEEEETHHHHHHHHHHHHHHHTT----CCCEEEEEEES
T ss_pred             cccccchhhhhhhhhhhHHHHhHHH--------h-CcChhHEEEEeeecCCcceeechhhhhhcc----ccccceeeeec
Confidence            9999999999999999999998865        5 789999999999999999998887765442    34688999999


Q ss_pred             cccCCCCCCccccC--CCccccCHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCccccCCCCEEEEEeCcCcChhHHHH
Q 020140          203 PFFGGVARTKSELG--PSEAMLNLELLDSFWRLSLPIGETRDHPYANPFGPESPSLEVVSLDPMLVVASEIELLKDRAKD  280 (330)
Q Consensus       203 p~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Pvli~~G~~D~~~~~~~~  280 (330)
                      |+++..........  ..............+...............+|+......     +||++|++|+.|++.+++..
T Consensus       189 p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~sp~~~~~~~-----~pP~li~~g~~D~l~d~~~~  263 (311)
T d1jjia_         189 PVVNFVAPTPSLLEFGEGLWILDQKIMSWFSEQYFSREEDKFNPLASVIFADLEN-----LPPALIITAEYDPLRDEGEV  263 (311)
T ss_dssp             CCCCSSSCCHHHHHTSSSCSSCCHHHHHHHHHHHCSSGGGGGCTTTSGGGSCCTT-----CCCEEEEEEEECTTHHHHHH
T ss_pred             ceeeeccCcccccccccccccccHHHhhhhhhhcccccccccccccchhhccccc-----CCCEEEEEcCCCCChHHHHH
Confidence            99987655443332  233445566666666666655555555666776655443     89999999999999999999


Q ss_pred             HHHHHHHCCCCEEEEEeCCCceeeeccCCCcHHHHHHHHHHHHHhh
Q 020140          281 YAKRLKAMGKTIDFVEFKGQQHGFFTNEPFSEASNEFLKVVEKFMS  326 (330)
Q Consensus       281 ~~~~l~~~g~~~~~~~~~~~~H~~~~~~~~~~~~~~~~~~i~~fl~  326 (330)
                      |+++|+++|+++++++|+|++|+|....+..++.++++++|.+||.
T Consensus       264 ~~~~L~~~Gv~v~~~~~~g~~H~F~~~~~~~~~a~~a~~~i~~fl~  309 (311)
T d1jjia_         264 FGQMLRRAGVEASIVRYRGVLHGFINYYPVLKAARDAINQIAALLV  309 (311)
T ss_dssp             HHHHHHHTTCCEEEEEEEEEETTGGGGTTTCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHCCCCEEEEEECCCCCccccCCCcCHHHHHHHHHHHHHhC
Confidence            9999999999999999999999998877778899999999999984



>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} Back     information, alignment and structure