BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 020166
         (330 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3VM8|A Chain A, Crystal Structure Of The Human Apobec3c Having Hiv-1
           Vif-Binding Interface
 pdb|3VM8|B Chain B, Crystal Structure Of The Human Apobec3c Having Hiv-1
           Vif-Binding Interface
 pdb|3VOW|A Chain A, Crystal Structure Of The Human Apobec3c Having Hiv-1
           Vif-Binding Interface
 pdb|3VOW|B Chain B, Crystal Structure Of The Human Apobec3c Having Hiv-1
           Vif-Binding Interface
          Length = 190

 Score = 32.0 bits (71), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 5/51 (9%)

Query: 139 RSQIIAAIPGTFFCAWYASQKHWLAN--NTLGLAFCIQGIEMLSLGSFKTG 187
           R+ + A  PGTF+   +  +  W AN  N   L F ++GI+  S+ S+KTG
Sbjct: 6   RNPMKAMYPGTFY---FQFKNLWEANDRNETWLCFTVEGIKRRSVVSWKTG 53


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.141    0.447 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,498,741
Number of Sequences: 62578
Number of extensions: 312159
Number of successful extensions: 640
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 640
Number of HSP's gapped (non-prelim): 2
length of query: 330
length of database: 14,973,337
effective HSP length: 99
effective length of query: 231
effective length of database: 8,778,115
effective search space: 2027744565
effective search space used: 2027744565
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 52 (24.6 bits)