Citrus Sinensis ID: 020188


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MTALADSKPVSVEAKPGLATALLSVFSSGPYSPKLKTVNKPWFNSFPPKPLNIVYPEEKGTYEVILFFHGTALSNTSYSNLLDHLASHGYIVVAPQLYDFLPPKGNGEVNDAANVLNWLSTGLQSELPENVEANLNYVALMGHSRGGLIAFGLALGYATNPPVSIKISALVGIDPVAGLASVHSELEPPILSHDSFEFSIPVTVIGTGLGGVTKCMQPCAPENKNHEQFFKRCTYSDHAHFDAKDYGHMDILDDNPQGPKNWAISKFLCTNGKKPRDPMRRCVAGIAAAFLKAYFDGDCEDFRTMLKDPSLAPIELDEVEFIPAARAKA
cccccccccccccccccccccccccccccccccEEEEECcccccccccccEEEEECccccccEEEEEEcccccccccHHHHHHHHHHcccEEEECcccccccccccHHHHHHHHHHHHHHHccccccccccccccccEEEEEccccHHHHHHHHHcccccccccccccEEEEcccccccccccccccccccccccccccccEEEEEcccccccccccccccccccHHHHHHHcccccCEEEEEccccccccccccccccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccccccccccccccccccc
******************ATALLSVFSSGPYSPKLKTVNKPWFNSFPPKPLNIVYPEEKGTYEVILFFHGTALSNTSYSNLLDHLASHGYIVVAPQLYDFLPPKGNGEVNDAANVLNWLSTGLQSELPENVEANLNYVALMGHSRGGLIAFGLALGYATNPPVSIKISALVGIDPVAGLASVHSELEPPILSHDSFEFSIPVTVIGTGLGGVTKCMQPCAPENKNHEQFFKRCTYSDHAHFDAKDYGHMDILDDNPQGPKNWAISKFLCTNGKKPRDPMRRCVAGIAAAFLKAYFDGDCEDFRTMLKDPSLAPIELDEVEFI*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTALADSKPVSVEAKPGLATALLSVFSSGPYSPKLKTVNKPWFNSFPPKPLNIVYPEEKGTYEVILFFHGTALSNTSYSNLLDHLASHGYIVVAPQLYDFLPPKGNGEVNDAANVLNWLSTGLQSELPENVEANLNYVALMGHSRGGLIAFGLALGYATNPPVSIKISALVGIDPVAGLASVHSELEPPILSHDSFEFSIPVTVIGTGLGGVTKCMQPCAPENKNHEQFFKRCTYSDHAHFDAKDYGHMDILDDNPQGPKNWAISKFLCTNGKKPRDPMRRCVAGIAAAFLKAYFDGDCEDFRTMLKDPSLAPIELDEVEFIPAARAKA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Chlorophyllase-1, chloroplastic Catalyzes the hydrolysis of ester bond in chlorophyll to yield chlorophyllide and phytol.probableQ94LX1
Chlorophyllase-1 Catalyzes the hydrolysis of ester bond in chlorophyll to yield chlorophyllide and phytol. Shows a preferential activity toward chlorophyll a.probableO22527

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.1.-Carboxylic ester hydrolases.probable
3.1.1.14Chlorophyllase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VIS, chain A
Confidence level:very confident
Coverage over the Query: 27-180,194-254,276-305
View the alignment between query and template
View the model in PyMOL
Template: 3HLK, chain A
Confidence level:confident
Coverage over the Query: 47-295
View the alignment between query and template
View the model in PyMOL