BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 020228
(329 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2BOY|A Chain A, Crystal Structure Of 3-Chlorocatechol 1,2-Dioxygenase From
Rhodococcus Opacus 1cp
pdb|2BOY|B Chain B, Crystal Structure Of 3-Chlorocatechol 1,2-Dioxygenase From
Rhodococcus Opacus 1cp
pdb|2BOY|C Chain C, Crystal Structure Of 3-Chlorocatechol 1,2-Dioxygenase From
Rhodococcus Opacus 1cp
pdb|2BOY|D Chain D, Crystal Structure Of 3-Chlorocatechol 1,2-Dioxygenase From
Rhodococcus Opacus 1cp
pdb|2BOY|E Chain E, Crystal Structure Of 3-Chlorocatechol 1,2-Dioxygenase From
Rhodococcus Opacus 1cp
pdb|2BOY|F Chain F, Crystal Structure Of 3-Chlorocatechol 1,2-Dioxygenase From
Rhodococcus Opacus 1cp
pdb|2BOY|G Chain G, Crystal Structure Of 3-Chlorocatechol 1,2-Dioxygenase From
Rhodococcus Opacus 1cp
pdb|2BOY|H Chain H, Crystal Structure Of 3-Chlorocatechol 1,2-Dioxygenase From
Rhodococcus Opacus 1cp
Length = 254
Score = 28.9 bits (63), Expect = 3.6, Method: Compositional matrix adjust.
Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 13/61 (21%)
Query: 11 LPVSEPARGDEGEKERLLKGDEKLFRGSAMTRRGANAAISYMACAVLLVMFNKAALSSYN 70
+P + P R DE GD +FRG + + GA A VLL M+ A Y+
Sbjct: 88 IPYTMPMRDDE-------SGDTLIFRGEVVDQEGAPLA------DVLLDMWQADAAGEYS 134
Query: 71 F 71
F
Sbjct: 135 F 135
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.328 0.140 0.428
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,295,544
Number of Sequences: 62578
Number of extensions: 294200
Number of successful extensions: 537
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 537
Number of HSP's gapped (non-prelim): 1
length of query: 329
length of database: 14,973,337
effective HSP length: 99
effective length of query: 230
effective length of database: 8,778,115
effective search space: 2018966450
effective search space used: 2018966450
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 52 (24.6 bits)