Citrus Sinensis ID: 020240


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MVLEFLGDSLLRLIKYSRYKGLELNKVREICKYILTGLDYLHRELGIIHTDLKPENILLVSTIDPSKDPIRSGLTPILERPEGSINGGSTSTMTIVEKKLKRRAKRAVANISIRRASMGGIELPKPERCLDGIDMRCKVVDFGNACRANKQFAEEIQTRQYRAPEVILRAGYSFSVDMWSFACTAFELATGDMLFAPKSGQGFCEDEDHLALMMELIGKMPRKIAIGGAQSKDYFDRHGDLKRIRRLKFWSLDRLLVDKYRFSETDAREFAEFLVPLLDFTPEKRPTAQQCLQHPWLSLRNSTRDETKNKSNVEKVDVGMSKLEIKVGK
ccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEEEccccccccccccccccccccccEEEEcccccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccHHHHHcccccHHHccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHcccccccccccHHHHHcccccccccccccccccccccccccccccccEEEccc
EEEEccccEHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccEEcccccHHHEEEEEEcccccccccccEEEEEEcccccHHccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEcccEEEEEccHHHcEEccEccccccccHHHccHHHHHccccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHccccHHHHHHcccHHHHEcccccEcccccccEccHHHHHHHcccccHHHHHHHHHHHcccccccccccEcHHHHHccHHHccccccccccccccccHccccccccccccccc
MVLEFLGDSLLRLIKYSRYKGLELNKVREICKYILTGLDYLHRElgiihtdlkpenillvstidpskdpirsgltpilerpegsinggstsTMTIVEKKLKRRAKRAVANISIRrasmggielpkpercldgidmRCKVVDFGNACRANKQFAEEIQTRQYRAPEVILRAGYSFSVDMWSFACTAFELAtgdmlfapksgqgfcedEDHLALMMELIGKMprkiaiggaqskdyfdrhgdlkriRRLKFWSLDRLLVDKYRFSETDAREFAEFLVplldftpekrptaqqclqhpwlslrnstrdetknksnvekvDVGMSKLEIKVGK
mvleflgdSLLRLIKYsrykglelnkvREICKYILTGLDYLHRELGIIHTDLKPENILLVstidpskdpirsgltpilerpegsinggststmTIVEKKlkrrakravanisirrasmggielpkperCLDGIDMRCKVVDFGNACRANKQFAeeiqtrqyraPEVILRAGYSFSVDMWSFACTAFELATGDMLFAPKSGQGFCEDEDHLALMMELIGKMPRKIAIGgaqskdyfdrhgdlkrirrlkfwsldrlLVDKYRFSETDAREFAEFLVPLLDFTPEKRPtaqqclqhpwlslrnstrdetknksnvekvdvgmskleikvgk
MVLEFLGDSLLRLIKYSRYKGLELNKVREICKYILTGLDYLHRELGIIHTDLKPENILLVSTIDPSKDPIRSGLTPILERPEGSINGGSTSTMTIVEkklkrrakravaNISIRRASMGGIELPKPERCLDGIDMRCKVVDFGNACRANKQFAEEIQTRQYRAPEVILRAGYSFSVDMWSFACTAFELATGDMLFAPKSGQGFCEDEDHLALMMELIGKMPRKIAIGGAQSKDYFDRHGDLKRIRRLKFWSLDRLLVDKYRFSETDAREFAEFLVPLLDFTPEKRPTAQQCLQHPWLSLRNSTRDETKNKSNVEKVDVGMSKLEIKVGK
**LEFLGDSLLRLIKYSRYKGLELNKVREICKYILTGLDYLHRELGIIHTDLKPENILLVSTI*******************************************AVANISIRRASMGGIELPKPERCLDGIDMRCKVVDFGNACRANKQFAEEIQTRQYRAPEVILRAGYSFSVDMWSFACTAFELATGDMLFAPKSGQGFCEDEDHLALMMELIGKMPRKIAIGGAQSKDYFDRHGDLKRIRRLKFWSLDRLLVDKYRFSETDAREFAEFLVPLLDFTPE****AQQCLQHPWL********************************
MVLEFLGDSLLRLIKYSRYKGLELNKVREICKYILTGLDYLHRELGIIHTDLKPENILLVSTIDPSKDPIRSGLTPILERP**********TMTIVEKKLKRR*************SMGGIELPKPERCLDGIDMRCKVVDFGNACRANKQFAEEIQTRQYRAPEVILRAGYSFSVDMWSFACTAFELATGDMLFAPKSGQGFCEDEDHLALMMELIGKMPRKIAIGGAQSKDYFDRHGDLK*****************YRFSETDAREFAEFLVPLLDFTPEKRPTAQQCLQHPW*********************************
MVLEFLGDSLLRLIKYSRYKGLELNKVREICKYILTGLDYLHRELGIIHTDLKPENILLVSTIDPSKDPIRSGLTPILERPEGSINGGSTSTMTIVEK********AVANISIRRASMGGIELPKPERCLDGIDMRCKVVDFGNACRANKQFAEEIQTRQYRAPEVILRAGYSFSVDMWSFACTAFELATGDMLFAPKSGQGFCEDEDHLALMMELIGKMPRKIAIGGAQSKDYFDRHGDLKRIRRLKFWSLDRLLVDKYRFSETDAREFAEFLVPLLDFTPEKRPTAQQCLQHPWLSLRNSTRDETKNKSNVEKVDVGMSKLEIKVGK
MVLEFLGDSLLRLIKYSRYKGLELNKVREICKYILTGLDYLHRELGIIHTDLKPENILLVSTIDPSKDPIRSGLTPILERPEGSINGGSTSTMTIVEKKLKRRAKRAVANISIRRASMGGIELPKPERCLDGIDMRCKVVDFGNACRANKQFAEEIQTRQYRAPEVILRAGYSFSVDMWSFACTAFELATGDMLFAPKSGQGFCEDEDHLALMMELIGKMPRKIAIGGAQSKDYFDRHGDLKRIRRLKFWSLDRLLVDKYRFSETDAREFAEFLVPLLDFTPEKRPTAQQCLQHPWLSLRNS*******KS*V****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLEFLGDSLLRLIKYSRYKGLELNKVREICKYILTGLDYLHRELGIIHTDLKPENILLVSTIDPSKDPIRSGLTPILERPEGSINGGSTSTMTIVEKKLKRRAKRAVANISIRRASMGGIELPKPERCLDGIDMRCKVVDFGNACRANKQFAEEIQTRQYRAPEVILRAGYSFSVDMWSFACTAFELATGDMLFAPKSGQGFCEDEDHLALMMELIGKMPRKIAIGGAQSKDYFDRHGDLKRIRRLKFWSLDRLLVDKYRFSETDAREFAEFLVPLLDFTPEKRPTAQQCLQHPWLSLRNSTRDETKNKSNVEKVDVGMSKLEIKVGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query329 2.2.26 [Sep-21-2011]
Q45FA5426 Serine/threonine-protein N/A no 0.838 0.647 0.413 2e-60
P36616544 Protein kinase dsk1 OS=Sc yes no 0.899 0.544 0.353 7e-55
Q5RD27655 SRSF protein kinase 1 OS= yes no 0.553 0.277 0.5 8e-52
Q96SB4655 SRSF protein kinase 1 OS= yes no 0.553 0.277 0.5 8e-52
O70551648 SRSF protein kinase 1 OS= yes no 0.498 0.253 0.524 5e-51
P78362688 SRSF protein kinase 2 OS= no no 0.647 0.309 0.437 1e-50
O54781681 SRSF protein kinase 2 OS= no no 0.498 0.240 0.524 2e-50
Q86A12656 Probable serine/threonine yes no 0.492 0.246 0.552 1e-48
Q9UPE1567 SRSF protein kinase 3 OS= no no 0.498 0.289 0.487 2e-46
B8Y466566 SRSF protein kinase 3 OS= no no 0.498 0.289 0.493 2e-46
>sp|Q45FA5|SRPK_PHYPO Serine/threonine-protein kinase SRPK OS=Physarum polycephalum PE=1 SV=1 Back     alignment and function desciption
 Score =  232 bits (592), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 126/305 (41%), Positives = 180/305 (59%), Gaps = 29/305 (9%)

Query: 1   MVLEFLGDSLLRLIKYSRYKGLELNKVREICKYILTGLDYLHRELGIIHTDLKPENILLV 60
           MV E LG +LL LIK   YKG+ L  V+ + K IL GLDYLH +  IIHTDLKPEN+LL 
Sbjct: 138 MVFEKLGSNLLDLIKLHNYKGIPLPLVKCMTKQILIGLDYLHTKCKIIHTDLKPENVLLD 197

Query: 61  STIDPSKDPIRSGLTPILERPEGSINGGSTSTMTIVEKKLKRRAKRAVANISIRRASMGG 120
             + P            L   +  ++G S+S+       +   A+ A      R+   G 
Sbjct: 198 HLLRPD----------TLNWDDQFLDGASSSS------PISNDAENA------RQTRSGK 235

Query: 121 IELPKPERCLDGIDMR------CKVVDFGNACRANKQFAEEIQTRQYRAPEVILRAGYSF 174
           I+     R  D +  +       K+ D G AC  +K F +++QTRQYR PEVIL   +  
Sbjct: 236 IKWEPSARIADSLSRKIVKVPIVKIADLGTACWTHKHFTDDVQTRQYRCPEVILGQKWDT 295

Query: 175 SVDMWSFACTAFELATGDMLFAPKSGQGFCEDEDHLALMMELIGKMPRKIAIGGAQSKDY 234
           ++DMWS AC  FELATGD+LF PK G  + + +DHLALM+EL+G+MPR     G++S+ Y
Sbjct: 296 TIDMWSLACMVFELATGDLLFCPKKGDKYDKTDDHLALMIELLGRMPRSFITKGSKSEKY 355

Query: 235 FDRHGDLKRIRRL-KFWSLDRLLVDKYRFSETDAREFAEFLVPLLDFTPEKRPTAQQCLQ 293
           F+  G+LK IR+L   W +  +L +KYRF + +A + + FL+P+L + PEKR TA+  L+
Sbjct: 356 FNSKGELKYIRKLGPQWGMSDVLYEKYRFPKEEADKLSAFLLPMLQYEPEKRATARDSLE 415

Query: 294 HPWLS 298
           HP+++
Sbjct: 416 HPYMA 420




Phosphorylates serine/arginine-rich protein PSR.
Physarum polycephalum (taxid: 5791)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|P36616|DSK1_SCHPO Protein kinase dsk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dsk1 PE=3 SV=2 Back     alignment and function description
>sp|Q5RD27|SRPK1_PONAB SRSF protein kinase 1 OS=Pongo abelii GN=SRPK1 PE=2 SV=2 Back     alignment and function description
>sp|Q96SB4|SRPK1_HUMAN SRSF protein kinase 1 OS=Homo sapiens GN=SRPK1 PE=1 SV=2 Back     alignment and function description
>sp|O70551|SRPK1_MOUSE SRSF protein kinase 1 OS=Mus musculus GN=Srpk1 PE=1 SV=2 Back     alignment and function description
>sp|P78362|SRPK2_HUMAN SRSF protein kinase 2 OS=Homo sapiens GN=SRPK2 PE=1 SV=3 Back     alignment and function description
>sp|O54781|SRPK2_MOUSE SRSF protein kinase 2 OS=Mus musculus GN=Srpk2 PE=1 SV=2 Back     alignment and function description
>sp|Q86A12|SKY1_DICDI Probable serine/threonine-protein kinase sky1 OS=Dictyostelium discoideum GN=sky1 PE=3 SV=1 Back     alignment and function description
>sp|Q9UPE1|SRPK3_HUMAN SRSF protein kinase 3 OS=Homo sapiens GN=SRPK3 PE=2 SV=2 Back     alignment and function description
>sp|B8Y466|SRPK3_PIG SRSF protein kinase 3 OS=Sus scrofa GN=SRPK3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query329
224084119 442 predicted protein [Populus trichocarpa] 0.984 0.733 0.835 1e-157
225438452 444 PREDICTED: serine/threonine-protein kina 0.990 0.734 0.811 1e-156
255561431 445 srpk, putative [Ricinus communis] gi|223 0.987 0.730 0.801 1e-155
147806137 463 hypothetical protein VITISV_038749 [Viti 0.984 0.699 0.807 1e-154
356531335 445 PREDICTED: serine/threonine-protein kina 0.993 0.734 0.802 1e-153
356531337 460 PREDICTED: serine/threonine-protein kina 0.993 0.710 0.802 1e-153
224114475 442 predicted protein [Populus trichocarpa] 0.984 0.733 0.802 1e-152
356559181 445 PREDICTED: serine/threonine-protein kina 0.993 0.734 0.787 1e-151
449434086 444 PREDICTED: SRSF protein kinase 1-like [C 0.990 0.734 0.784 1e-150
356496553 445 PREDICTED: probable serine/threonine-pro 0.990 0.732 0.769 1e-146
>gi|224084119|ref|XP_002307217.1| predicted protein [Populus trichocarpa] gi|222856666|gb|EEE94213.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  562 bits (1448), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 275/329 (83%), Positives = 302/329 (91%), Gaps = 5/329 (1%)

Query: 1   MVLEFLGDSLLRLIKYSRYKGLELNKVREICKYILTGLDYLHRELGIIHTDLKPENILLV 60
           MVLEFLGDSLLRLI+++RYKGLEL+KVREICK I+TGLDYLHRELGIIH+DLKPENILL 
Sbjct: 119 MVLEFLGDSLLRLIRHNRYKGLELDKVREICKCIVTGLDYLHRELGIIHSDLKPENILLF 178

Query: 61  STIDPSKDPIRSGLTPILERPEGSINGGSTSTMTIVEKKLKRRAKRAVANISIRRASMGG 120
           STIDP+KDPIRSGLTPILERPEG+ NG  TSTMT++EKKLKRRAKRAVA IS RR SMGG
Sbjct: 179 STIDPAKDPIRSGLTPILERPEGNHNG--TSTMTLIEKKLKRRAKRAVAKISGRRVSMGG 236

Query: 121 IELPKPERCLDGIDMRCKVVDFGNACRANKQFAEEIQTRQYRAPEVILRAGYSFSVDMWS 180
             + KPER LDGID+RCKVVDFGNAC A+KQFAEEIQTRQYRAPEVILR+GYSFSVDMWS
Sbjct: 237 -AVQKPERSLDGIDVRCKVVDFGNACWADKQFAEEIQTRQYRAPEVILRSGYSFSVDMWS 295

Query: 181 FACTAFELATGDMLFAPKSGQGFCEDEDHLALMMELIGKMPRKIAIGGAQSKDYFDRHGD 240
           FACTAFELATGDMLFAPK GQ + EDEDHLALMMEL+GKMPRKIAIGGA SKDYFDRHGD
Sbjct: 296 FACTAFELATGDMLFAPKDGQDYSEDEDHLALMMELLGKMPRKIAIGGALSKDYFDRHGD 355

Query: 241 LKRIRRLKFWSLDRLLVDKYRFSETDAREFAEFLVPLLDFTPEKRPTAQQCLQHPWLSLR 300
           LKRIRRLKFW LDRLLV+KY+FSE DAREFAEFL PL DFTPEKRPTAQQCLQHPWL+L+
Sbjct: 356 LKRIRRLKFWPLDRLLVEKYKFSENDAREFAEFLCPLFDFTPEKRPTAQQCLQHPWLNLK 415

Query: 301 NSTRDETKNKSNVEKVDVGMSKLEIKVGK 329
           +ST++ETK++S V K+ VG+S L  KVGK
Sbjct: 416 SSTQNETKSESKVAKLGVGVSNL--KVGK 442




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225438452|ref|XP_002277212.1| PREDICTED: serine/threonine-protein kinase SRPK2 [Vitis vinifera] gi|296082557|emb|CBI21562.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255561431|ref|XP_002521726.1| srpk, putative [Ricinus communis] gi|223539117|gb|EEF40713.1| srpk, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147806137|emb|CAN70006.1| hypothetical protein VITISV_038749 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356531335|ref|XP_003534233.1| PREDICTED: serine/threonine-protein kinase SRPK1-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356531337|ref|XP_003534234.1| PREDICTED: serine/threonine-protein kinase SRPK1-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|224114475|ref|XP_002332363.1| predicted protein [Populus trichocarpa] gi|222874680|gb|EEF11811.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356559181|ref|XP_003547879.1| PREDICTED: serine/threonine-protein kinase SRPK1-like [Glycine max] Back     alignment and taxonomy information
>gi|449434086|ref|XP_004134827.1| PREDICTED: SRSF protein kinase 1-like [Cucumis sativus] gi|449491257|ref|XP_004158842.1| PREDICTED: SRSF protein kinase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356496553|ref|XP_003517131.1| PREDICTED: probable serine/threonine-protein kinase sky1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query329
TAIR|locus:2053938440 AT2G17530 [Arabidopsis thalian 0.960 0.718 0.734 2.6e-125
TAIR|locus:2127903439 AT4G35500 [Arabidopsis thalian 0.963 0.722 0.728 6.3e-124
TAIR|locus:2085151529 SRPK4 "ser/arg-rich protein ki 0.592 0.368 0.571 2.1e-88
TAIR|locus:2172651538 AT5G22840 [Arabidopsis thalian 0.750 0.459 0.476 9.2e-86
TAIR|locus:2082107534 AT3G44850 [Arabidopsis thalian 0.522 0.322 0.610 1.5e-85
UNIPROTKB|B4DS61639 SRPK1 "SFRS protein kinase 1, 0.553 0.284 0.5 3.3e-63
UNIPROTKB|H3BLV9671 SRPK1 "SRSF protein kinase 1" 0.553 0.271 0.5 3.3e-63
UNIPROTKB|Q96SB4655 SRPK1 "SRSF protein kinase 1" 0.553 0.277 0.5 3.3e-63
UNIPROTKB|Q5RD27655 SRPK1 "SRSF protein kinase 1" 0.553 0.277 0.5 3.3e-63
UNIPROTKB|B7UCT2655 SRPK1 "SFRS protein kinase 1" 0.498 0.250 0.530 8.8e-63
TAIR|locus:2053938 AT2G17530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1231 (438.4 bits), Expect = 2.6e-125, P = 2.6e-125
 Identities = 241/328 (73%), Positives = 276/328 (84%)

Query:     1 MVLEFLGDSLLRLIKYSRYKGLELNKVREICKYILTGLDYLHRELGIIHTDLKPENILLV 60
             MVLEFLGDSLLRLIKY+RYKG+EL+KVREICK ILTGLDYLHRELG+IH+DLKPENILL 
Sbjct:   119 MVLEFLGDSLLRLIKYNRYKGMELSKVREICKCILTGLDYLHRELGMIHSDLKPENILLC 178

Query:    61 STIDPSKDPIRSGLTPILERPEGSINGGSTSTMTIVEXXXXXXXXXXXXNISIRRASMGG 120
             STIDP+KDPIRSGLTPILE+PEG+ NG  TSTM ++E             IS RR S+ G
Sbjct:   179 STIDPAKDPIRSGLTPILEKPEGNQNG--TSTMNLIEKKLKRRAKKAAAKISGRRVSIVG 236

Query:   121 I-ELPKP-ERCLDGIDMRCKVVDFGNACRANKQFAEEIQTRQYRAPEVILRAGYSFSVDM 178
             + E PK  +R LDGIDMRCKVVDFGN C A+ +FAEEIQTRQYRAPEVIL++GYS+SVDM
Sbjct:   237 LSETPKKNKRNLDGIDMRCKVVDFGNGCWADNKFAEEIQTRQYRAPEVILQSGYSYSVDM 296

Query:   179 WSFACTAFELATGDMLFAPKSGQGFCEDEDHLALMMELIGKMPRKIAIGGAQSKDYFDRH 238
             WSFACTAFELATGDMLFAPK G G+ EDEDHLALMMEL+GKMPRKIAIGGA+SKDYFDRH
Sbjct:   297 WSFACTAFELATGDMLFAPKEGNGYGEDEDHLALMMELLGKMPRKIAIGGARSKDYFDRH 356

Query:   239 GDLKRIRRLKFWSLDRLLVDKYRFSETDAREFAEFLVPLLDFTPEKRPTAQQCLQHPWLS 298
             GDLKRIRRLK+W LDRLL+DKY+  E +AREFA+FL P++DF PEKRPTAQQCLQHPWL+
Sbjct:   357 GDLKRIRRLKYWPLDRLLIDKYKLPEAEAREFADFLCPIMDFAPEKRPTAQQCLQHPWLN 416

Query:   299 LRNSTRDETKNKSNVEKVDVGMSKLEIK 326
             LR      T+N  N + ++  MS ++IK
Sbjct:   417 LR------TQN--NEDDIEGQMSNMQIK 436




GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
TAIR|locus:2127903 AT4G35500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085151 SRPK4 "ser/arg-rich protein kinase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172651 AT5G22840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082107 AT3G44850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|B4DS61 SRPK1 "SFRS protein kinase 1, isoform CRA_f" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H3BLV9 SRPK1 "SRSF protein kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q96SB4 SRPK1 "SRSF protein kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RD27 SRPK1 "SRSF protein kinase 1" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|B7UCT2 SRPK1 "SFRS protein kinase 1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.10.737
3rd Layer2.7.110.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_V000420
hypothetical protein (442 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query329
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 7e-25
PTZ00284467 PTZ00284, PTZ00284, protein kinase; Provisional 2e-22
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 7e-21
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 1e-20
pfam00069260 pfam00069, Pkinase, Protein kinase domain 4e-20
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 2e-17
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 3e-17
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 7e-17
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 1e-16
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 2e-16
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 3e-16
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 3e-15
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 3e-14
cd07849336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 3e-14
cd07880343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 5e-14
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 1e-13
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 1e-13
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 2e-13
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 3e-13
cd07857332 cd07857, STKc_MPK1, Catalytic domain of the Serine 4e-13
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 6e-13
cd07848287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 9e-13
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 2e-12
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 2e-12
pfam00069260 pfam00069, Pkinase, Protein kinase domain 1e-11
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 1e-11
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 1e-11
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 3e-11
cd07853372 cd07853, STKc_NLK, Catalytic domain of the Serine/ 4e-11
cd07850353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 4e-11
cd07858337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 7e-11
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 7e-11
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 9e-11
cd07879342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 1e-10
cd07877345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 1e-10
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 2e-10
cd07878343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 2e-10
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 2e-10
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 3e-10
cd07876359 cd07876, STKc_JNK2, Catalytic domain of the Serine 5e-10
cd07874355 cd07874, STKc_JNK3, Catalytic domain of the Serine 9e-10
cd07875364 cd07875, STKc_JNK1, Catalytic domain of the Serine 1e-09
cd07859338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 1e-09
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 3e-09
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 3e-09
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 3e-09
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 4e-09
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 4e-09
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 5e-09
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 5e-09
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 5e-09
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 6e-09
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 1e-08
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 1e-08
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 1e-08
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 1e-08
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 1e-08
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 1e-08
cd07854342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 1e-08
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 1e-08
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 2e-08
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 2e-08
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 2e-08
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 3e-08
cd07842316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 3e-08
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 4e-08
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 6e-08
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 9e-08
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 9e-08
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 9e-08
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 1e-07
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 2e-07
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 2e-07
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 2e-07
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 2e-07
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 2e-07
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 3e-07
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 3e-07
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 3e-07
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 3e-07
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 4e-07
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 4e-07
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 5e-07
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 9e-07
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 9e-07
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 1e-06
PTZ00024335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 1e-06
PHA03212391 PHA03212, PHA03212, serine/threonine kinase US3; P 1e-06
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 1e-06
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 2e-06
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 2e-06
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 2e-06
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 2e-06
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 3e-06
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 4e-06
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 4e-06
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 5e-06
cd07869303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 7e-06
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 7e-06
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 8e-06
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 9e-06
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 9e-06
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 9e-06
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 1e-05
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 1e-05
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 2e-05
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 2e-05
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 2e-05
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 2e-05
cd05629377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 3e-05
cd07842316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 4e-05
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 4e-05
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 4e-05
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 4e-05
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 5e-05
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 5e-05
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 5e-05
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 6e-05
PHA03209357 PHA03209, PHA03209, serine/threonine kinase US3; P 7e-05
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 8e-05
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 1e-04
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 1e-04
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 1e-04
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 1e-04
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 1e-04
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 1e-04
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 1e-04
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 1e-04
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 2e-04
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 2e-04
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 2e-04
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 2e-04
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 2e-04
PTZ00036440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 2e-04
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 2e-04
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 2e-04
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 2e-04
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 2e-04
cd07868317 cd07868, STKc_CDK8, Catalytic domain of the Serine 3e-04
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 3e-04
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 3e-04
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 4e-04
cd07870291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 4e-04
PLN03224507 PLN03224, PLN03224, probable serine/threonine prot 4e-04
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 4e-04
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 4e-04
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 4e-04
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 4e-04
cd07865310 cd07865, STKc_CDK9, Catalytic domain of the Serine 5e-04
cd07880343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 6e-04
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 6e-04
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 6e-04
cd07867317 cd07867, STKc_CDC2L6, Catalytic domain of Serine/T 6e-04
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 6e-04
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 6e-04
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 7e-04
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 7e-04
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 7e-04
cd05610 669 cd05610, STKc_MASTL, Catalytic domain of the Prote 7e-04
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 7e-04
PHA03211461 PHA03211, PHA03211, serine/threonine kinase US3; P 7e-04
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 8e-04
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 8e-04
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 9e-04
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 0.001
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 0.001
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 0.001
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 0.001
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 0.001
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 0.001
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 0.001
cd06615308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 0.001
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 0.001
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 0.001
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 0.001
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 0.001
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 0.001
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 0.002
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 0.002
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 0.002
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 0.002
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 0.002
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 0.002
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 0.002
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 0.002
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 0.002
cd07849336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 0.003
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 0.003
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 0.003
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 0.003
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 0.003
cd05616323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 0.003
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 0.003
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 0.003
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 0.004
cd06615308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 0.004
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 0.004
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 0.004
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 0.004
PHA03390267 PHA03390, pk1, serine/threonine-protein kinase 1; 0.004
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
 Score =  100 bits (252), Expect = 7e-25
 Identities = 48/175 (27%), Positives = 69/175 (39%), Gaps = 46/175 (26%)

Query: 125 KPERCLDGIDMRCKVVDFGNACRAN--KQFAEEIQTRQYRAPEVILRAGYSFSVDMWSFA 182
           KPE  L   D   K+ DFG A + +  ++    + T +Y APEV+L  GY  +VD+WS  
Sbjct: 124 KPENILLDEDGHVKLADFGLARQLDPGEKLTTFVGTPEYMAPEVLLGKGYGKAVDIWSLG 183

Query: 183 CTAFELATGDMLFAPKSGQGFCEDEDHLALMMELIGKMPRKIAIGGAQSKDYFDRHGDLK 242
              +EL TG   F           +D L  + + IGK                       
Sbjct: 184 VILYELLTGKPPF---------PGDDQLLELFKKIGKPK--------------------- 213

Query: 243 RIRRLKFWSLDRLLVDKYRFSETDAREFAEFLVPLLDFTPEKRPTAQQCLQHPWL 297
                 F         ++  S     E  + +  LL   PEKR TA++ LQHP+ 
Sbjct: 214 ----PPFPP------PEWDISP----EAKDLIRKLLVKDPEKRLTAEEALQHPFF 254


Phosphotransferases. Serine or threonine-specific kinase subfamily. Length = 254

>gnl|CDD|140307 PTZ00284, PTZ00284, protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|178763 PLN03224, PLN03224, probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 329
KOG1290590 consensus Serine/threonine protein kinase [Signal 100.0
KOG0667586 consensus Dual-specificity tyrosine-phosphorylatio 100.0
KOG0671415 consensus LAMMER dual specificity kinases [Signal 100.0
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG0660359 consensus Mitogen-activated protein kinase [Signal 100.0
KOG0661 538 consensus MAPK related serine/threonine protein ki 100.0
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG0663419 consensus Protein kinase PITSLRE and related kinas 100.0
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 100.0
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 100.0
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 100.0
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 100.0
PTZ00284467 protein kinase; Provisional 100.0
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 100.0
KOG0575 592 consensus Polo-like serine/threonine protein kinas 100.0
KOG0578550 consensus p21-activated serine/threonine protein k 100.0
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 100.0
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG0616355 consensus cAMP-dependent protein kinase catalytic 100.0
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 100.0
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 100.0
KOG0598357 consensus Ribosomal protein S6 kinase and related 100.0
KOG0583370 consensus Serine/threonine protein kinase [Signal 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 100.0
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 100.0
KOG0198313 consensus MEKK and related serine/threonine protei 100.0
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 100.0
PTZ00036440 glycogen synthase kinase; Provisional 100.0
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 100.0
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 100.0
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 100.0
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 100.0
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 100.0
KOG0582 516 consensus Ste20-like serine/threonine protein kina 100.0
KOG0599411 consensus Phosphorylase kinase gamma subunit [Carb 100.0
KOG0605550 consensus NDR and related serine/threonine kinases 100.0
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 100.0
PHA03212391 serine/threonine kinase US3; Provisional 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 100.0
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 100.0
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.98
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.98
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.98
KOG0666438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.98
KOG4717 864 consensus Serine/threonine protein kinase [Signal 99.98
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.98
KOG0595 429 consensus Serine/threonine-protein kinase involved 99.98
KOG0610459 consensus Putative serine/threonine protein kinase 99.98
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.98
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.98
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.97
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.97
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.97
PHA03207392 serine/threonine kinase US3; Provisional 99.97
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.97
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.97
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.97
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 99.97
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.97
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.97
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.97
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.97
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.97
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.97
KOG0694694 consensus Serine/threonine protein kinase [Signal 99.97
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.97
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.97
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.97
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.97
KOG0192362 consensus Tyrosine kinase specific for activated ( 99.97
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.97
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.97
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.97
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.97
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.97
PHA03209357 serine/threonine kinase US3; Provisional 99.97
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.97
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.97
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.97
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.97
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.97
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 99.97
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.97
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.97
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 99.97
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.97
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.97
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.97
KOG0201 467 consensus Serine/threonine protein kinase [Signal 99.97
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.97
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.97
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.97
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.97
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.97
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.97
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.97
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.97
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.97
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.97
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 99.97
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.97
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.97
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.97
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.97
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.97
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.97
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.97
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.97
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.97
PHA03211461 serine/threonine kinase US3; Provisional 99.97
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.97
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 99.97
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.97
KOG0607463 consensus MAP kinase-interacting kinase and relate 99.97
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.97
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.97
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.97
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.97
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.97
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 99.97
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.97
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.97
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.97
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.97
KOG0589 426 consensus Serine/threonine protein kinase [General 99.97
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.97
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.97
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.97
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.97
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.96
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.96
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.96
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 99.96
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.96
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.96
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.96
PTZ00283 496 serine/threonine protein kinase; Provisional 99.96
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.96
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.96
KOG0197468 consensus Tyrosine kinases [Signal transduction me 99.96
PTZ00267 478 NIMA-related protein kinase; Provisional 99.96
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.96
PLN00009294 cyclin-dependent kinase A; Provisional 99.96
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.96
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.96
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.96
PHA02988283 hypothetical protein; Provisional 99.96
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.96
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.96
KOG0596677 consensus Dual specificity; serine/threonine and t 99.96
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.96
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.96
PHA03210501 serine/threonine kinase US3; Provisional 99.96
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.96
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.96
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.96
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.96
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.96
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.96
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.96
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.96
KOG0577 948 consensus Serine/threonine protein kinase [Signal 99.96
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.96
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.96
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.96
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.96
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.96
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.96
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.96
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.96
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.96
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.96
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.96
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.96
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.96
KOG1989 738 consensus ARK protein kinase family [Signal transd 99.96
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.96
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.96
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.96
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 99.96
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.96
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.96
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.96
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.96
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.96
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.96
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 99.96
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.96
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 99.96
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.96
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.96
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.96
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.96
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.96
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.96
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.96
KOG0611 668 consensus Predicted serine/threonine protein kinas 99.96
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.96
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.96
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.96
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.96
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.96
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.96
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.96
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.96
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.96
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.96
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.96
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.96
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.96
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.95
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.95
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.95
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.95
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.95
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.95
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.95
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.95
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.95
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.95
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.95
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.95
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 99.95
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.95
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.95
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.95
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.95
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.95
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.95
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.95
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.95
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.95
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.95
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.95
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.95
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.95
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.95
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.95
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.95
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.95
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.95
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.95
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.95
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.95
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.95
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.95
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.95
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.95
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.95
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.95
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.95
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.95
KOG0690516 consensus Serine/threonine protein kinase [Signal 99.95
KOG4721 904 consensus Serine/threonine protein kinase, contain 99.95
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.95
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.95
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.95
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.95
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.95
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.95
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.95
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.95
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.95
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.95
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.95
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.95
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.95
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.95
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.94
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.94
PHA02882294 putative serine/threonine kinase; Provisional 99.94
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.94
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.94
PLN00181 793 protein SPA1-RELATED; Provisional 99.94
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.94
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.94
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.94
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.94
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.94
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.94
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.94
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.94
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.94
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.94
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.94
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.94
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.94
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.94
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.94
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.94
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 99.94
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.94
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.94
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.94
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.94
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.94
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.94
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.94
KOG0586 596 consensus Serine/threonine protein kinase [General 99.94
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.94
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.94
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.94
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.94
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.94
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.94
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.94
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.94
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.94
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.94
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.94
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.94
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.94
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.94
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.94
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.94
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.94
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.94
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.94
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.94
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.94
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.94
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.94
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.94
KOG0584 632 consensus Serine/threonine protein kinase [General 99.94
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 99.94
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.94
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.94
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.94
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.93
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.93
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.93
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.93
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.93
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.93
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.93
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.93
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.93
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.93
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.93
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.93
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.93
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.93
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.93
KOG1026774 consensus Nerve growth factor receptor TRKA and re 99.93
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.93
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.93
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 99.93
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.93
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.93
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.93
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.93
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.93
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.93
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 99.93
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.93
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.93
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.93
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.93
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.93
KOG1167418 consensus Serine/threonine protein kinase of the C 99.93
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.93
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.93
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.93
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.93
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.92
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.92
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.92
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 99.92
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.92
KOG06081034 consensus Warts/lats-like serine threonine kinases 99.92
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.92
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.92
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.92
PLN03224507 probable serine/threonine protein kinase; Provisio 99.92
KOG1187361 consensus Serine/threonine protein kinase [Signal 99.92
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.92
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.91
KOG1027 903 consensus Serine/threonine protein kinase and endo 99.91
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 99.91
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.91
KOG0695593 consensus Serine/threonine protein kinase [Signal 99.91
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.9
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 99.89
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.89
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.88
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 99.87
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.87
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.87
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.87
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.85
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 99.84
KOG1345378 consensus Serine/threonine kinase [Signal transduc 99.83
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.82
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.82
KOG2052513 consensus Activin A type IB receptor, serine/threo 99.81
KOG3653534 consensus Transforming growth factor beta/activin 99.81
KOG1152772 consensus Signal transduction serine/threonine kin 99.77
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.74
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.72
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.7
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.67
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.67
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.66
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 99.65
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.65
KOG1165449 consensus Casein kinase (serine/threonine/tyrosine 99.65
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.64
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 99.64
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 99.37
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.36
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 99.28
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.27
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.27
PRK12274218 serine/threonine protein kinase; Provisional 99.25
KOG0590 601 consensus Checkpoint kinase and related serine/thr 99.25
PRK09188365 serine/threonine protein kinase; Provisional 99.23
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.19
KOG06061205 consensus Microtubule-associated serine/threonine 99.0
smart00090237 RIO RIO-like kinase. 98.98
PRK10345210 hypothetical protein; Provisional 98.91
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 98.82
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 98.8
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 98.78
PRK14879211 serine/threonine protein kinase; Provisional 98.78
KOG1266458 consensus Protein kinase [Signal transduction mech 98.74
KOG0601 524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.7
PRK09605535 bifunctional UGMP family protein/serine/threonine 98.67
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 98.64
KOG2137 700 consensus Protein kinase [Signal transduction mech 98.62
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 98.56
COG4248 637 Uncharacterized protein with protein kinase and he 98.39
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.39
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 98.27
KOG3087229 consensus Serine/threonine protein kinase [General 98.25
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 98.22
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 98.21
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 98.2
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 98.17
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 98.07
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 98.05
PRK04750537 ubiB putative ubiquinone biosynthesis protein UbiB 97.85
KOG1243 690 consensus Protein kinase [General function predict 97.66
PRK09902216 hypothetical protein; Provisional 97.49
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 97.45
COG1718268 RIO1 Serine/threonine protein kinase involved in c 97.23
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 97.03
COG0478304 RIO-like serine/threonine protein kinase fused to 96.6
COG0661517 AarF Predicted unusual protein kinase [General fun 96.49
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 96.44
KOG1235538 consensus Predicted unusual protein kinase [Genera 96.02
KOG2270520 consensus Serine/threonine protein kinase involved 94.78
KOG1826 2724 consensus Ras GTPase activating protein RasGAP/neu 94.48
KOG3741655 consensus Poly(A) ribonuclease subunit [RNA proces 94.47
KOG1093 725 consensus Predicted protein kinase (contains TBC a 94.42
PRK05231319 homoserine kinase; Provisional 91.92
cd05157235 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. 91.91
cd05156302 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The 91.69
TIGR00938307 thrB_alt homoserine kinase, Neisseria type. Homose 91.05
COG0510269 ycfN Thiamine kinase and related kinases [Coenzyme 91.04
TIGR02906313 spore_CotS spore coat protein, CotS family. Member 90.48
cd05155235 APH_ChoK_like_1 Uncharacterized bacterial proteins 89.74
cd05153296 HomoserineK_II Homoserine Kinase, type II. Homoser 89.12
KOG0576 829 consensus Mitogen-activated protein kinase kinase 88.97
KOG2268465 consensus Serine/threonine protein kinase [Signal 88.0
PF01636239 APH: Phosphotransferase enzyme family This family 87.42
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 86.99
PRK10271188 thiK thiamine kinase; Provisional 86.7
cd05150244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 86.67
TIGR02721256 ycfN_thiK thiamine kinase. Members of this family 86.33
PF01633211 Choline_kinase: Choline/ethanolamine kinase; Inter 86.32
smart00587196 CHK ZnF_C4 abd HLH domain containing kinases domai 85.59
TIGR02904309 spore_ysxE spore coat protein YsxE. Members of thi 85.37
COG2334331 Putative homoserine kinase type II (protein kinase 84.61
PF12260188 PIP49_C: Protein-kinase domain of FAM69; InterPro: 84.04
PLN02236344 choline kinase 83.49
PRK11768325 serine/threonine protein kinase; Provisional 81.95
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=4.1e-48  Score=354.18  Aligned_cols=326  Identities=53%  Similarity=0.897  Sum_probs=242.6

Q ss_pred             CcccccchhHHHHHHhhcCCCcchHHHHHHHHHHHHHHHHHHhhCCccccCCCCCceeeecC-CCCCCCCCCCC-CCCcc
Q 020240            1 MVLEFLGDSLLRLIKYSRYKGLELNKVREICKYILTGLDYLHRELGIIHTDLKPENILLVST-IDPSKDPIRSG-LTPIL   78 (329)
Q Consensus         1 lV~e~~g~sL~~~~~~~~~~~l~~~~~~~i~~qll~al~~lH~~~giiH~Dlk~~Nil~~~~-~~~~~~~~~~~-~~~~~   78 (329)
                      ||+|++|.+|..+|.+..++++++..++.||+|||.||.|||.+|||||.||||+|||+... .+....+.+.. ....+
T Consensus       163 MVfEvLGdnLLklI~~s~YrGlpl~~VK~I~~qvL~GLdYLH~ecgIIHTDlKPENvLl~~~e~~~~~~~~~a~e~~~~~  242 (590)
T KOG1290|consen  163 MVFEVLGDNLLKLIKYSNYRGLPLSCVKEICRQVLTGLDYLHRECGIIHTDLKPENVLLCSTEIDPAKDAREAGEATTSL  242 (590)
T ss_pred             EEehhhhhHHHHHHHHhCCCCCcHHHHHHHHHHHHHHHHHHHHhcCccccCCCcceeeeeccccchhhhhhhhccccccC
Confidence            69999999999999999999999999999999999999999999999999999999999654 23333332222 11111


Q ss_pred             c--CCCCCCCCC--------CC-chhHHH--HHHHHHHhhhhccc-----------------------hhhcccccCC--
Q 020240           79 E--RPEGSINGG--------ST-STMTIV--EKKLKRRAKRAVAN-----------------------ISIRRASMGG--  120 (329)
Q Consensus        79 ~--~~~~~~~~~--------~~-~~~~~~--~~~~~~~~~~~~~~-----------------------~~~~~~~~~~--  120 (329)
                      .  .+.+..+..        .. ......  +...+++.++....                       .....+....  
T Consensus       243 p~~s~s~~~t~~d~~~~~~~~~~s~~~~k~~~kk~~r~~~~~~~~l~~~~~~~~~~~~~s~n~~~~~n~~~~~v~~~~~~  322 (590)
T KOG1290|consen  243 PKMSPSAVSTRPDALQRMAAEPMSKSKFKKMKKKLKRQAKKLEASLAGLEGIEEEPNQESYNNEPRINGNESTVERSTLE  322 (590)
T ss_pred             CCCCcccccccccccchhhccccchhhHHHHHHHHhhhhhhhhhhhcccccccccccccccccccCCCccccchhhcccc
Confidence            1  001111100        00 000000  11111111000000                       0000000000  


Q ss_pred             -----------------------------------------ccCCC-------------CCccCCCCCCceEEeecCccc
Q 020240          121 -----------------------------------------IELPK-------------PERCLDGIDMRCKVVDFGNAC  146 (329)
Q Consensus       121 -----------------------------------------~~~~~-------------~~~~~~~~~~~~~l~Dfg~a~  146 (329)
                                                               ...++             +.........+|||+|||.|+
T Consensus       323 ~~~~~~~~~~n~~~k~~e~~~~~~~sl~~~~~~~~~t~~~~~~~s~~s~~~~~~n~~v~p~~~~~~~di~vKIaDlGNAC  402 (590)
T KOG1290|consen  323 EDSNENGNRENLPIKSPENFRGNNTSLPESQLRDSATPSDGSLSSPSSPGTIASNPLVNPDIPLPECDIRVKIADLGNAC  402 (590)
T ss_pred             cccccccCCccccccCccccccccccccchhcccccccccccccCcCCccccccccccCCCCCCCccceeEEEeeccchh
Confidence                                                     00000             000112345679999999999


Q ss_pred             ccccccccCCCCCCCcchHHhhcCCCCccchHHHHHHHHHHHHhCCcCCCCCCCCCCCCchHHHHHHHHHhCCCcHHHHh
Q 020240          147 RANKQFAEEIQTRQYRAPEVILRAGYSFSVDMWSFACTAFELATGDMLFAPKSGQGFCEDEDHLALMMELIGKMPRKIAI  226 (329)
Q Consensus       147 ~~~~~~~~~~~~~~y~aPE~~~~~~~s~~~DiwslG~il~~l~~g~~pf~~~~~~~~~~~~~~l~~i~~~~g~~p~~~~~  226 (329)
                      .....++..+.|..|++||+++|..|+..+||||++|++|||+||-++|...++..+..+.+|++.|++++|.+|..+..
T Consensus       403 W~~khFT~DIQTRQYRapEVllGsgY~~~ADiWS~AC~~FELaTGDyLFePhsG~~Y~rDEDHiA~i~ELLG~iPr~ia~  482 (590)
T KOG1290|consen  403 WVHKHFTEDIQTRQYRAPEVLLGSGYSTSADIWSTACMAFELATGDYLFEPHSGENYSRDEDHIALIMELLGKIPRKIAL  482 (590)
T ss_pred             hhhhhhchhhhhhhccCcceeecCCCCCchhHHHHHHHHHHhhcCceeecCCCCCCCCccHHHHHHHHHHHhhccHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCccccCccCchhhhccccccchhHHHhhhcCCChhhHHHHHHHHhhccCCCCCCCcCHHHHhcCCCcCCCCCChhh
Q 020240          227 GGAQSKDYFDRHGDLKRIRRLKFWSLDRLLVDKYRFSETDAREFAEFLVPLLDFTPEKRPTAQQCLQHPWLSLRNSTRDE  306 (329)
Q Consensus       227 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dll~~~L~~dP~~R~ta~ell~hpwf~~~~~~~~~  306 (329)
                      ...+++.||+..|.++.+.++..|.+.+++..+|.++.++..+|.|||.-||+++|++|+||+++|+|||+....-+...
T Consensus       483 ~Gk~SRdFFnr~G~LrhI~~LK~WpL~~VL~eKY~~s~e~A~~fsdFL~PmLef~PeKR~tA~~cl~hPwLn~~~~~~~~  562 (590)
T KOG1290|consen  483 GGKYSRDFFNRRGELRHIRRLKPWPLYEVLIEKYEWSEEDAQQFSDFLSPMLEFDPEKRPTAAQCLKHPWLNPVAGPPPS  562 (590)
T ss_pred             cCcchHhhhccccceecccccCCCcHHHHHHHHhCCCHHHHHHHHHHHHHHHhcCccccccHHHHhcCccccCCCCCccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999966543333


Q ss_pred             hhcCC----Cccccccccceeeee
Q 020240          307 TKNKS----NVEKVDVGMSKLEIK  326 (329)
Q Consensus       307 ~~~~~----~~~~~~~~~~~~~~~  326 (329)
                      .+...    --+.+...+..+.++
T Consensus       563 ~~~~~~~~~~~e~v~~~~~~~~~~  586 (590)
T KOG1290|consen  563 DSPQNEENNEEEDVEGWMNNSRIK  586 (590)
T ss_pred             cCCccccccccccccccccccccc
Confidence            22222    333444455554443



>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1235 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>KOG2270 consensus Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1826 consensus Ras GTPase activating protein RasGAP/neurofibromin [Defense mechanisms] Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] Back     alignment and domain information
>PRK05231 homoserine kinase; Provisional Back     alignment and domain information
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes Back     alignment and domain information
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes Back     alignment and domain information
>TIGR00938 thrB_alt homoserine kinase, Neisseria type Back     alignment and domain information
>COG0510 ycfN Thiamine kinase and related kinases [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR02906 spore_CotS spore coat protein, CotS family Back     alignment and domain information
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members Back     alignment and domain information
>cd05153 HomoserineK_II Homoserine Kinase, type II Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2268 consensus Serine/threonine protein kinase [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>PRK10271 thiK thiamine kinase; Provisional Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>TIGR02721 ycfN_thiK thiamine kinase Back     alignment and domain information
>PF01633 Choline_kinase: Choline/ethanolamine kinase; InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2 Back     alignment and domain information
>smart00587 CHK ZnF_C4 abd HLH domain containing kinases domain Back     alignment and domain information
>TIGR02904 spore_ysxE spore coat protein YsxE Back     alignment and domain information
>COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only] Back     alignment and domain information
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) Back     alignment and domain information
>PLN02236 choline kinase Back     alignment and domain information
>PRK11768 serine/threonine protein kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query329
1wbp_A397 Srpk1 Bound To 9mer Docking Motif Peptide Length = 1e-66
3beg_A381 Crystal Structure Of Sr Protein Kinase 1 Complexed 1e-66
2x7g_A389 Structure Of Human Serine-Arginine-Rich Protein-Spe 6e-64
1how_A373 The X-Ray Crystal Structure Of Sky1p, An Sr Protein 8e-51
1q8y_A373 The Structure Of The Yeast Sr Protein Kinase, Sky1p 8e-51
3llt_A360 Crystal Structure Of Pf14_0431, Kinase Domain Lengt 3e-23
1z57_A339 Crystal Structure Of Human Clk1 In Complex With 10z 5e-20
2vag_A339 Crystal Structure Of Di-Phosphorylated Human Clk1 I 2e-19
3nr9_A368 Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length 3e-18
3kvw_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 3e-17
3k2l_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 4e-17
4azf_A417 Human Dyrk2 In Complex With Leucettine L41 Length = 8e-17
2exe_A357 Crystal Structure Of The Phosphorylated Clk3 Length 5e-15
2wu6_A381 Crystal Structure Of The Human Clk3 In Complex With 5e-15
2eu9_A355 Crystal Structure Of Clk3 Length = 355 5e-15
3anq_A368 Human Dyrk1aINHIBITOR COMPLEX Length = 368 4e-14
2vx3_A382 Crystal Structure Of The Human Dual Specificity Tyr 2e-13
4aze_A382 Human Dyrk1a In Complex With Leucettine L41 Length 2e-13
1cm8_A367 Phosphorylated Map Kinase P38-Gamma Length = 367 3e-11
3oht_A389 Crystal Structure Of Salmo Salar P38alpha Length = 2e-10
2zoq_A382 Structural Dissection Of Human Mitogen-Activated Ki 2e-10
3sa0_A360 Complex Of Erk2 With Norathyriol Length = 360 3e-10
2pk9_A317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 3e-10
3vuk_A370 Crystal Structure Of A Cysteine-deficient Mutant M5 4e-10
4e5a_X360 The W197a Mutant Of P38a Map Kinase Length = 360 4e-10
3vui_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 4e-10
3vuh_A370 Crystal Structure Of A Cysteine-deficient Mutant M3 4e-10
4fv7_A360 Crystal Structure Of The Erk2 Complexed With E94 Le 4e-10
3v3v_A379 Structural And Functional Analysis Of Quercetagetin 5e-10
3fi3_A364 Crystal Structure Of Jnk3 With Indazole Inhibitor, 5e-10
1yw2_A360 Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 5e-10
3kvx_A364 Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le 5e-10
2ghl_A348 Mutant Mus Musculus P38 Kinase Domain In Complex Wi 6e-10
2r9s_A356 C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu 6e-10
3e7o_A360 Crystal Structure Of Jnk2 Length = 360 6e-10
3vug_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 6e-10
3fv8_A355 Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Le 7e-10
3vud_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 7e-10
1pme_A380 Structure Of Penta Mutant Human Erk2 Map Kinase Com 7e-10
3fi2_A353 Crystal Structure Of Jnk3 With Amino-Pyrazole Inhib 8e-10
3py3_A380 Crystal Structure Of Phosphorylated P38alpha Map Ki 8e-10
3tei_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 8e-10
3npc_A364 Crystal Structure Of Jnk2 Complexed With Birb796 Le 9e-10
3tg1_A380 Crystal Structure Of P38alpha In Complex With A Map 9e-10
4gsb_A364 Monoclinic Crystal Form Of The Apo-Erk2 Length = 36 9e-10
1bmk_A379 The Complex Structure Of The Map Kinase P38SB218655 9e-10
1ywr_A360 Crystal Structure Analysis Of Inactive P38 Kinase D 9e-10
2ok1_A365 Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3 1e-09
4fux_A360 Crystal Structure Of The Erk2 Complexed With E75 Le 1e-09
3gc9_A370 The Structure Of P38beta C119s, C162s In Complex Wi 1e-09
3oxi_A362 Design And Synthesis Of Disubstituted Thiophene And 1e-09
1jnk_A423 The C-Jun N-Terminal Kinase (Jnk3s) Complexed With 1e-09
3d83_A360 Crystal Structure Of P38 Kinase In Complex With A B 1e-09
2ojg_A380 Crystal Structure Of Erk2 In Complex With N,n-dimet 1e-09
2o0u_A364 Crystal Structure Of Human Jnk3 Complexed With N-{3 1e-09
1pmn_A364 Crystal Structure Of Jnk3 In Complex With An Imidaz 1e-09
3qyw_A364 Crystal Structure Of Erk2 In Complex With An Inhibi 1e-09
3e92_A371 Crystal Structure Of P38 Kinase In Complex With A B 1e-09
3ptg_A363 Design And Synthesis Of A Novel, Orally Efficacious 1e-09
2gtm_A348 Mutated Mouse P38 Map Kinase Domain In Complex With 1e-09
3p4k_A370 The Third Conformation Of P38a Map Kinase Observed 1e-09
1lew_A360 Crystal Structure Of Map Kinase P38 Complexed To Th 1e-09
2exc_X356 Inhibitor Complex Of Jnk3 Length = 356 1e-09
3ttj_A464 Crystal Structure Of Jnk3 Complexed With Cc-359, A 1e-09
2bal_A365 P38alpha Map Kinase Bound To Pyrazoloamine Length = 1e-09
4h3q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 1e-09
2baq_A365 P38alpha Bound To Ro3201195 Length = 365 1e-09
4h36_A356 Crystal Structure Of Jnk3 In Complex With Atf2 Pept 1e-09
3gc8_A370 The Structure Of P38beta C162s In Complex With A Di 1e-09
2puu_A348 Crystal Structure Of P38 Complex With 1-(5-Tert-But 1e-09
2b1p_A355 Inhibitor Complex Of Jnk3 Length = 355 1e-09
2y9q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 1e-09
2oza_B366 Structure Of P38alpha Complex Length = 366 1e-09
1wzy_A368 Crystal Structure Of Human Erk2 Complexed With A Py 1e-09
1tvo_A368 The Structure Of Erk2 In Complex With A Small Molec 1e-09
3zuv_A364 Crystal Structure Of A Designed Selected Ankyrin Re 1e-09
2erk_A365 Phosphorylated Map Kinase Erk2 Length = 365 1e-09
4exu_A371 Mapk13, Inactive Form Length = 371 1e-09
3coi_A353 Crystal Structure Of P38delta Kinase Length = 353 1e-09
2y8o_A362 Crystal Structure Of Human P38alpha Complexed With 1e-09
3o71_A358 Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length 1e-09
4fv6_A360 Crystal Structure Of The Erk2 Complexed With E57 Le 1e-09
3dt1_A383 P38 Complexed With A Quinazoline Inhibitor Length = 1e-09
3kq7_A380 Structure Of Human P38alpha With N-[4-Methyl-3-(6-{ 1e-09
1bl6_A379 The Complex Structure Of The Map Kinase P38SB216995 2e-09
3fi4_A372 P38 Kinase Crystal Structure In Complex With Ro4499 2e-09
1ove_A366 The Structure Of P38 Alpha In Complex With A Dihydr 2e-09
3zu7_A365 Crystal Structure Of A Designed Selected Ankyrin Re 2e-09
2z7l_A366 Unphosphorylated Mitogen Activated Protein Kinase E 2e-09
3c9w_A357 Crystal Structure Of Erk-2 With Hypothemycin Covale 2e-09
2fys_B364 Crystal Structure Of Erk2 Complex With Kim Peptide 2e-09
3nnx_A354 Crystal Structure Of Phosphorylated P38 Alpha In Co 2e-09
1gol_A364 Coordinates Of Rat Map Kinase Erk2 With An Arginine 2e-09
1m7q_A366 Crystal Structure Of P38 Map Kinase In Complex With 2e-09
3eb0_A383 Crystal Structure Of Cgd4_240 From Cryptosporidium 2e-09
3mpt_A371 Crystal Structure Of P38 Kinase In Complex With A P 2e-09
3k3j_A362 P38alpha Bound To Novel Dfg-Out Compound Pf-0041612 2e-09
1oz1_A372 P38 Mitogen-Activated Kinase In Complex With 4-Azai 2e-09
2gfs_A372 P38 Kinase Crystal Structure In Complex With Ro3201 2e-09
3zsg_A362 X-Ray Structure Of P38alpha Bound To Tak-715 Length 2e-09
3d7z_A360 Crystal Structure Of P38 Kinase In Complex With A B 2e-09
3k3i_A350 P38alpha Bound To Novel Dgf-Out Compound Pf-0021595 2e-09
3gcu_A360 Human P38 Map Kinase In Complex With Rl48 Length = 2e-09
2gph_A364 Docking Motif Interactions In The Map Kinase Erk2 L 2e-09
3od6_X360 Crystal Structure Of P38alpha Y323t Active Mutant L 2e-09
3hec_A348 P38 In Complex With Imatinib Length = 348 2e-09
1ian_A366 Human P38 Map Kinase Inhibitor Complex Length = 366 2e-09
2lgc_A359 Joint Nmr And X-Ray Refinement Reveals The Structur 2e-09
1di9_A360 The Structure Of P38 Mitogen-Activated Protein Kina 2e-09
4ewq_A383 Human P38 Alpha Mapk In Complex With A Pyridazine B 2e-09
3s3i_A349 P38 Kinase Crystal Structure In Complex With Small 2e-09
2baj_A365 P38alpha Bound To Pyrazolourea Length = 365 2e-09
3hrb_A359 P38 Kinase Crystal Structure In Complex With Small 2e-09
3hvc_A362 Crystal Structure Of Human P38alpha Map Kinase Leng 2e-09
1zzl_A351 Crystal Structure Of P38 With Triazolopyridine Leng 2e-09
3gp0_A348 Crystal Structure Of Human Mitogen Activated Protei 2e-09
3odz_X360 Crystal Structure Of P38alpha Y323r Active Mutant L 2e-09
3ody_X360 Crystal Structure Of P38alpha Y323q Active Mutant L 2e-09
3nnu_A354 Crystal Structure Of P38 Alpha In Complex With Dp13 2e-09
2npq_A367 A Novel Lipid Binding Site In The P38 Alpha Map Kin 2e-09
3oef_X360 Crystal Structure Of Y323f Inactive Mutant Of P38al 2e-09
1ukh_A369 Structural Basis For The Selective Inhibition Of Jn 3e-09
3vum_A370 Crystal Structure Of A Cysteine-deficient Mutant M7 3e-09
2xrw_A371 Linear Binding Motifs For Jnk And For Calcineurin A 3e-09
2xs0_A386 Linear Binding Motifs For Jnk And For Calcineurin A 3e-09
3o17_A370 Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3 3e-09
2fst_X367 Mitogen Activated Protein Kinase P38alpha (d176a+f3 3e-09
3vul_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 3e-09
2fsl_X367 Mitogen Activated Protein Kinase P38alpha (D176a+f3 4e-09
2fso_X367 Mitogen Activated Protein Kinase P38alpha (D176a) A 4e-09
2g01_A370 Pyrazoloquinolones As Novel, Selective Jnk1 Inhibit 4e-09
3mh2_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 4e-09
3r63_A358 Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 5e-09
3gcp_A360 Human P38 Map Kinase In Complex With Sb203580 Lengt 6e-09
1bi8_A326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 7e-09
3nup_A307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 8e-09
1jow_B308 Crystal Structure Of A Complex Of Human Cdk6 And A 1e-08
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 1e-08
3o8p_A360 Conformational Plasticity Of P38 Map Kinase Dfg Mot 1e-08
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 1e-08
3elj_A369 Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine 2e-08
3gi3_A360 Crystal Structure Of A N-Phenyl-N'-Naphthylurea Ana 2e-08
3pze_A358 Jnk1 In Complex With Inhibitor Length = 358 2e-08
3mh0_A360 Mutagenesis Of P38 Map Kinase Eshtablishes Key Role 2e-08
3mh1_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 2e-08
4e7w_A394 Structure Of Gsk3 From Ustilago Maydis Length = 394 3e-08
3mh3_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 3e-08
3rp9_A458 Crystal Structure Of The Apo Mapk From Toxoplasma G 4e-08
3oz6_A388 Crystal Structure Of Mapk From Cryptosporidium Parv 5e-08
3mtl_A324 Crystal Structure Of The Pctaire1 Kinase In Complex 6e-08
2i6l_A320 Crystal Structure Of Human Mitogen Activated Protei 7e-08
2w96_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 7e-08
2w99_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 8e-08
3g33_A308 Crystal Structure Of Cdk4CYCLIN D3 Length = 308 9e-08
2w9f_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 1e-07
3n9x_A432 Crystal Structure Of Map Kinase From Plasmodium Ber 4e-07
4eon_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 5e-07
4eom_A301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 5e-07
3nie_A429 Crystal Structure Of Pf11_0147 Length = 429 6e-07
4eop_A300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 6e-07
4eoo_A299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 6e-07
4eoi_A299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 6e-07
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 8e-07
3e3p_A360 Glycogen Synthase Kinase From Leishmania Major Leng 9e-07
4erw_A306 Cdk2 In Complex With Staurosporine Length = 306 1e-06
3pxf_A306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 1e-06
1gz8_A299 Human Cyclin Dependent Kinase 2 Complexed With The 1e-06
3ezr_A300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 1e-06
1oit_A299 Imidazopyridines: A Potent And Selective Class Of C 1e-06
3pj8_A299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 1e-06
1ogu_A302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 1e-06
1gii_A298 Human Cyclin Dependent Kinase 2 Complexed With The 1e-06
2w17_A299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 1e-06
1pf8_A298 Crystal Structure Of Human Cyclin-dependent Kinase 1e-06
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 1e-06
1fin_A298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 1e-06
4eoj_A302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 1e-06
1oir_A299 Imidazopyridines: A Potent And Selective Class Of C 1e-06
1h01_A298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 1e-06
2iw6_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 1e-06
2iw8_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 1e-06
1h1p_A303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 1e-06
4eok_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 1e-06
1vyw_A309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 1e-06
4eoq_A301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 1e-06
4bcq_A301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 1e-06
1ob3_A288 Structure Of P. Falciparum Pfpk5 Length = 288 1e-06
4eos_A300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 1e-06
3qhr_A298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 1e-06
1qmz_A299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 1e-06
1e9h_A297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 1e-06
3bht_A300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 1e-06
2jgz_A289 Crystal Structure Of Phospho-Cdk2 In Complex With C 1e-06
4i3z_A296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 1e-06
1w98_A298 The Structural Basis Of Cdk2 Activation By Cyclin E 2e-06
1jst_A298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 2e-06
1v0o_A288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 2e-06
2f9g_A353 Crystal Structure Of Fus3 Phosphorylated On Tyr182 2e-06
1v0b_A288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 3e-06
4b99_A398 Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le 3e-06
2gng_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 3e-06
4ic7_A442 Crystal Structure Of The Erk5 Kinase Domain In Comp 3e-06
2gnf_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 3e-06
2gnj_A350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 3e-06
2b9f_A353 Crystal Structure Of Non-Phosphorylated Fus3 Length 3e-06
3ama_A351 Protein Kinase A Sixfold Mutant Model Of Aurora B W 3e-06
3gbz_A329 Structure Of The Cmgc Cdk Kinase From Giardia Lambl 3e-06
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 4e-06
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 4e-06
4aaa_A331 Crystal Structure Of The Human Cdkl2 Kinase Domain 4e-06
3igo_A 486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 4e-06
3l9m_A351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 5e-06
1szm_A350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 5e-06
2b9h_A353 Crystal Structure Of Fus3 With A Docking Motif From 5e-06
1q61_A350 Pka Triple Mutant Model Of Pkb Length = 350 5e-06
2vo0_A351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 5e-06
2uvy_A351 Structure Of Pka-pkb Chimera Complexed With Methyl- 5e-06
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 5e-06
2jdt_A351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 5e-06
3fhi_A350 Crystal Structure Of A Complex Between The Catalyti 5e-06
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 5e-06
1j3h_A350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 5e-06
3mvj_A371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 6e-06
1xh9_A350 Crystal Structures Of Protein Kinase B Selective In 6e-06
4ae9_A343 Structure And Function Of The Human Sperm-specific 6e-06
3g51_A325 Structural Diversity Of The Active Conformation Of 6e-06
4dg3_E371 Crystal Structure Of R336a Mutant Of Camp-dependent 6e-06
4ae6_A343 Structure And Function Of The Human Sperm-specific 6e-06
2uzt_A336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 6e-06
2c1a_A351 Structure Of Camp-Dependent Protein Kinase Complexe 6e-06
1q8w_A350 The Catalytic Subunit Of Camp-Dependent Protein Kin 6e-06
2jds_A351 Structure Of Camp-Dependent Protein Kinase Complexe 6e-06
1stc_E350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 6e-06
1svh_A350 Crystal Structure Of Protein Kinase A In Complex Wi 6e-06
3nx8_A351 Human Camp Dependent Protein Kinase In Complex With 6e-06
3pvb_A345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 6e-06
3agm_A351 Complex Of Pka With The Bisubstrate Protein Kinase 6e-06
3agl_A351 Complex Of Pka With The Bisubstrate Protein Kinase 6e-06
1xh7_A350 Crystal Structures Of Protein Kinase B Selective In 7e-06
1ctp_E350 Structure Of The Mammalian Catalytic Subunit Of Cam 7e-06
3dnd_A350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 7e-06
1cmk_E350 Crystal Structures Of The Myristylated Catalytic Su 7e-06
2erz_E351 Crystal Structure Of C-amp Dependent Kinase (pka) B 7e-06
1l3r_E350 Crystal Structure Of A Transition State Mimic Of Th 7e-06
1jbp_E350 Crystal Structure Of The Catalytic Subunit Of Camp- 7e-06
2qur_A350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 7e-06
2qcs_A350 A Complex Structure Between The Catalytic And Regul 7e-06
1bkx_A350 A Binary Complex Of The Catalytic Subunit Of Camp-D 7e-06
1h4l_A292 Structure And Regulation Of The Cdk5-P25(Nck5a) Com 7e-06
1cdk_A350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 7e-06
1ydt_E350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 7e-06
2f7e_E351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 7e-06
1fmo_E350 Crystal Structure Of A Polyhistidine-Tagged Recombi 7e-06
1apm_E350 2.0 Angstrom Refined Crystal Structure Of The Catal 7e-06
3qal_E350 Crystal Structure Of Arg280ala Mutant Of Catalytic 7e-06
2gu8_A337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 7e-06
4dfx_E350 Crystal Structure Of Myristoylated K7c Catalytic Su 8e-06
4dfy_A371 Crystal Structure Of R194a Mutant Of Camp-Dependent 9e-06
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 1e-05
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 1e-05
1q24_A350 Pka Double Mutant Model Of Pkb In Complex With Mgat 1e-05
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 1e-05
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 1e-05
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 1e-05
1smh_A350 Protein Kinase A Variant Complex With Completely Or 1e-05
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 2e-05
1syk_A350 Crystal Structure Of E230q Mutant Of Camp-Dependent 2e-05
1ung_A292 Structural Mechanism For The Inhibition Of Cdk5-P25 2e-05
3uib_A362 Map Kinase Lmampk10 From Leishmania Major In Comple 2e-05
3pg1_A362 Map Kinase Lmampk10 From Leishmania Major (1.95 Ang 2e-05
3rzf_A 677 Crystal Structure Of Inhibitor Of Kappab Kinase Bet 2e-05
3qa8_A 676 Crystal Structure Of Inhibitor Of Kappa B Kinase Be 2e-05
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 2e-05
3db6_A301 Crystal Structure Of An Activated (Thr->asp) Polo-L 2e-05
3lij_A 494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 2e-05
3o7l_B350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 2e-05
3d5v_A317 Crystal Structure Of An Activated (Thr->asp) Polo-L 3e-05
3d5w_A317 Crystal Structure Of A Phosphorylated Polo-Like Kin 3e-05
3d5u_A317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 3e-05
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 3e-05
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 3e-05
4agu_A311 Crystal Structure Of The Human Cdkl1 Kinase Domain 3e-05
3qam_E350 Crystal Structure Of Glu208ala Mutant Of Catalytic 3e-05
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 4e-05
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 4e-05
3lm0_A327 Crystal Structure Of Human SerineTHREONINE KINASE 1 4e-05
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 4e-05
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 4e-05
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 4e-05
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 5e-05
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 5e-05
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 5e-05
2ou7_A335 Structure Of The Catalytic Domain Of Human Polo-Lik 6e-05
3pwy_A311 Crystal Structure Of An Extender (Spd28345)-Modifie 6e-05
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 6e-05
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 6e-05
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 6e-05
3thb_A333 Structure Of Plk1 Kinase Domain In Complex With A B 6e-05
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 6e-05
3kb7_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 6e-05
2v5q_A315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 6e-05
2yac_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 7e-05
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 7e-05
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 7e-05
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 7e-05
3zdi_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 8e-05
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 8e-05
4afj_A367 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selec 8e-05
1gng_A378 Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With 8e-05
3f7z_A350 X-ray Co-crystal Structure Of Glycogen Synthase Kin 8e-05
3f88_A349 Glycogen Synthase Kinase 3beta Inhibitor Complex Le 8e-05
2ow3_A352 Glycogen Synthase Kinase-3 Beta In Complex With Bis 8e-05
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 8e-05
4dit_A382 Crystal Structure Of Gsk3beta In Complex With A Imi 8e-05
3zrk_A371 Identification Of 2-(4-Pyridyl)thienopyridinones As 8e-05
2rku_A294 Structure Of Plk1 In Complex With Bi2536 Length = 2 8e-05
3gb2_A353 Gsk3beta Inhibitor Complex Length = 353 8e-05
1o9u_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 9e-05
1rdq_E350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 9e-05
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 9e-05
1uv5_A350 Glycogen Synthase Kinase 3 Beta Complexed With 6-Br 9e-05
1kob_A387 Twitchin Kinase Fragment (Aplysia), Autoregulated P 9e-05
3say_A430 Crystal Structure Of Human Glycogen Synthase Kinase 9e-05
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 1e-04
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 1e-04
3sd0_A350 Identification Of A Glycogen Synthase Kinase-3b Inh 1e-04
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 1e-04
1h8f_A352 Glycogen Synthase Kinase 3 Beta. Length = 352 1e-04
2o5k_A372 Crystal Structure Of Gsk3beta In Complex With A Ben 1e-04
1r0e_A391 Glycogen Synthase Kinase-3 Beta In Complex With 3-I 1e-04
4acc_A465 Gsk3b In Complex With Inhibitor Length = 465 1e-04
1ua2_A346 Crystal Structure Of Human Cdk7 Length = 346 1e-04
1q5k_A414 Crystal Structure Of Glycogen Synthase Kinase 3 In 1e-04
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 1e-04
1q3d_A424 Gsk-3 Beta Complexed With Staurosporine Length = 42 1e-04
1pyx_A422 Gsk-3 Beta Complexed With Amp-Pnp Length = 422 1e-04
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 1e-04
1i09_A420 Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Len 1e-04
3f5u_A295 Crystal Structure Of The Death Associated Protein K 1e-04
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 1e-04
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 1e-04
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 1e-04
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 1e-04
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 1e-04
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 2e-04
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 2e-04
4a07_A311 Human Pdk1 Kinase Domain In Complex With Allosteric 2e-04
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 2e-04
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 2e-04
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 2e-04
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 2e-04
2r7b_A312 Crystal Structure Of The Phosphoinositide-Dependent 2e-04
3nax_A311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 2e-04
3nun_A292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 2e-04
2biy_A310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 2e-04
2xck_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 2e-04
2xch_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 2e-04
3rwp_A311 Discovery Of A Novel, Potent And Selective Inhibito 2e-04
3nay_A311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 2e-04
1h1w_A289 High Resolution Crystal Structure Of The Human Pdk1 2e-04
3h9o_A311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 2e-04
1uu3_A310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 2e-04
3hrc_A311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 3e-04
1z5m_A286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 3e-04
3iop_A312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 3e-04
3sc1_A311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 3e-04
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 3e-04
3qc4_A314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 3e-04
3nus_A286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 3e-04
1uu9_A286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 3e-04
3orx_A316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 3e-04
2jed_A352 The Crystal Structure Of The Kinase Domain Of The P 3e-04
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 3e-04
2x7f_A326 Crystal Structure Of The Kinase Domain Of Human Tra 3e-04
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 3e-04
3cqu_A342 Crystal Structure Of Akt-1 Complexed With Substrate 4e-04
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 4e-04
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 4e-04
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 4e-04
4gv1_A340 Pkb Alpha In Complex With Azd5363 Length = 340 4e-04
3ocb_A341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 4e-04
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 4e-04
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 4e-04
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 4e-04
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 4e-04
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 4e-04
1fot_A318 Structure Of The Unliganded Camp-Dependent Protein 7e-04
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 7e-04
4fr4_A384 Crystal Structure Of Human SerineTHREONINE-Protein 7e-04
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 7e-04
2y94_A476 Structure Of An Active Form Of Mammalian Ampk Lengt 9e-04
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 9e-04
>pdb|1WBP|A Chain A, Srpk1 Bound To 9mer Docking Motif Peptide Length = 397 Back     alignment and structure

Iteration: 1

Score = 250 bits (638), Expect = 1e-66, Method: Compositional matrix adjust. Identities = 133/305 (43%), Positives = 182/305 (59%), Gaps = 37/305 (12%) Query: 1 MVLEFLGDSLLRLIKYSRYKGLELNKVREICKYILTGLDYLHRELGIIHTDLKPENILLV 60 MV E LG LL+ I S Y+GL L V++I + +L GLDYLH + IIHTD+KPENILL Sbjct: 122 MVFEVLGHHLLKWIIKSNYQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILLS 181 Query: 61 ST-------IDPSKDPIRSGLTPILERPEGSINGGSTSTMTIVEXXXXXXXXXXXXNISI 113 + + RSG P P GS +S Sbjct: 182 VNEQYIRRLAAEATEWQRSGAPP----PSGSA-------------------------VST 212 Query: 114 RRASMGGIELPKPERCLDGIDMRCKVVDFGNACRANKQFAEEIQTRQYRAPEVILRAGYS 173 A+ G L P + ++ K+ D GNAC +K F E+IQTRQYR+ EV++ +GY+ Sbjct: 213 APATAGNF-LVNPLEPKNAEKLKVKIADLGNACWVHKHFTEDIQTRQYRSLEVLIGSGYN 271 Query: 174 FSVDMWSFACTAFELATGDMLFAPKSGQGFCEDEDHLALMMELIGKMPRKIAIGGAQSKD 233 D+WS AC AFELATGD LF P SG+ + DEDH+AL++EL+GK+PRK+ + G SK+ Sbjct: 272 TPADIWSTACMAFELATGDYLFEPHSGEEYTRDEDHIALIIELLGKVPRKLIVAGKYSKE 331 Query: 234 YFDRHGDLKRIRRLKFWSLDRLLVDKYRFSETDAREFAEFLVPLLDFTPEKRPTAQQCLQ 293 +F + GDLK I +LK W L +LV+KY +S+ +A F +FL+P+L+ PEKR TA +CL+ Sbjct: 332 FFTKKGDLKHITKLKPWGLFEVLVEKYEWSQEEAAGFTDFLLPMLELIPEKRATAAECLR 391 Query: 294 HPWLS 298 HPWL+ Sbjct: 392 HPWLN 396
>pdb|3BEG|A Chain A, Crystal Structure Of Sr Protein Kinase 1 Complexed To Its Substrate AsfSF2 Length = 381 Back     alignment and structure
>pdb|2X7G|A Chain A, Structure Of Human Serine-Arginine-Rich Protein-Specific Kinase 2 (Srpk2) Bound To Purvalanol B Length = 389 Back     alignment and structure
>pdb|1HOW|A Chain A, The X-Ray Crystal Structure Of Sky1p, An Sr Protein Kinase In Yeast Length = 373 Back     alignment and structure
>pdb|1Q8Y|A Chain A, The Structure Of The Yeast Sr Protein Kinase, Sky1p, With Bound Adp Length = 373 Back     alignment and structure
>pdb|3LLT|A Chain A, Crystal Structure Of Pf14_0431, Kinase Domain Length = 360 Back     alignment and structure
>pdb|1Z57|A Chain A, Crystal Structure Of Human Clk1 In Complex With 10z-Hymenialdisine Length = 339 Back     alignment and structure
>pdb|2VAG|A Chain A, Crystal Structure Of Di-Phosphorylated Human Clk1 In Complex With A Novel Substituted Indole Inhibitor Length = 339 Back     alignment and structure
>pdb|3NR9|A Chain A, Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length = 368 Back     alignment and structure
>pdb|3KVW|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) In Complex With An Indirubin Ligand Length = 429 Back     alignment and structure
>pdb|3K2L|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) Length = 429 Back     alignment and structure
>pdb|4AZF|A Chain A, Human Dyrk2 In Complex With Leucettine L41 Length = 417 Back     alignment and structure
>pdb|2EXE|A Chain A, Crystal Structure Of The Phosphorylated Clk3 Length = 357 Back     alignment and structure
>pdb|2WU6|A Chain A, Crystal Structure Of The Human Clk3 In Complex With Dki Length = 381 Back     alignment and structure
>pdb|2EU9|A Chain A, Crystal Structure Of Clk3 Length = 355 Back     alignment and structure
>pdb|3ANQ|A Chain A, Human Dyrk1aINHIBITOR COMPLEX Length = 368 Back     alignment and structure
>pdb|2VX3|A Chain A, Crystal Structure Of The Human Dual Specificity Tyrosine- Phosphorylation-Regulated Kinase 1a Length = 382 Back     alignment and structure
>pdb|4AZE|A Chain A, Human Dyrk1a In Complex With Leucettine L41 Length = 382 Back     alignment and structure
>pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 Back     alignment and structure
>pdb|3OHT|A Chain A, Crystal Structure Of Salmo Salar P38alpha Length = 389 Back     alignment and structure
>pdb|2ZOQ|A Chain A, Structural Dissection Of Human Mitogen-Activated Kinase Erk1 Length = 382 Back     alignment and structure
>pdb|3SA0|A Chain A, Complex Of Erk2 With Norathyriol Length = 360 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|4E5A|X Chain X, The W197a Mutant Of P38a Map Kinase Length = 360 Back     alignment and structure
>pdb|3VUI|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUH|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M3 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|4FV7|A Chain A, Crystal Structure Of The Erk2 Complexed With E94 Length = 360 Back     alignment and structure
>pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 Back     alignment and structure
>pdb|3FI3|A Chain A, Crystal Structure Of Jnk3 With Indazole Inhibitor, Sr-3737 Length = 364 Back     alignment and structure
>pdb|1YW2|A Chain A, Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 Back     alignment and structure
>pdb|3KVX|A Chain A, Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Length = 364 Back     alignment and structure
>pdb|2GHL|A Chain A, Mutant Mus Musculus P38 Kinase Domain In Complex With Inhibitor Pg-874743 Length = 348 Back     alignment and structure
>pdb|2R9S|A Chain A, C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Quinoline Inhibitor Length = 356 Back     alignment and structure
>pdb|3E7O|A Chain A, Crystal Structure Of Jnk2 Length = 360 Back     alignment and structure
>pdb|3VUG|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3FV8|A Chain A, Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Length = 355 Back     alignment and structure
>pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|1PME|A Chain A, Structure Of Penta Mutant Human Erk2 Map Kinase Complexed With A Specific Inhibitor Of Human P38 Map Kinase Length = 380 Back     alignment and structure
>pdb|3FI2|A Chain A, Crystal Structure Of Jnk3 With Amino-Pyrazole Inhibitor, Sr- 3451 Length = 353 Back     alignment and structure
>pdb|3PY3|A Chain A, Crystal Structure Of Phosphorylated P38alpha Map Kinase Length = 380 Back     alignment and structure
>pdb|3TEI|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3NPC|A Chain A, Crystal Structure Of Jnk2 Complexed With Birb796 Length = 364 Back     alignment and structure
>pdb|3TG1|A Chain A, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 380 Back     alignment and structure
>pdb|4GSB|A Chain A, Monoclinic Crystal Form Of The Apo-Erk2 Length = 364 Back     alignment and structure
>pdb|1BMK|A Chain A, The Complex Structure Of The Map Kinase P38SB218655 Length = 379 Back     alignment and structure
>pdb|1YWR|A Chain A, Crystal Structure Analysis Of Inactive P38 Kinase Domain In Complex With A Monocyclic Pyrazolone Inhibitor Length = 360 Back     alignment and structure
>pdb|2OK1|A Chain A, Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3- Chlorophenyl)-1h-Pyrazol-3-Yl)-1h-Pyrrole-2-Carboxamide Length = 365 Back     alignment and structure
>pdb|4FUX|A Chain A, Crystal Structure Of The Erk2 Complexed With E75 Length = 360 Back     alignment and structure
>pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 Back     alignment and structure
>pdb|3OXI|A Chain A, Design And Synthesis Of Disubstituted Thiophene And Thiazole Based Inhibitors Of Jnk For The Treatment Of Neurodegenerative Diseases Length = 362 Back     alignment and structure
>pdb|1JNK|A Chain A, The C-Jun N-Terminal Kinase (Jnk3s) Complexed With Mgamp-Pnp Length = 423 Back     alignment and structure
>pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|2OJG|A Chain A, Crystal Structure Of Erk2 In Complex With N,n-dimethyl-4-(4- Phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide Length = 380 Back     alignment and structure
>pdb|2O0U|A Chain A, Crystal Structure Of Human Jnk3 Complexed With N-{3-Cyano-6-[3-(1- Piperidinyl)propanoyl]-4,5,6,7-Tetrahydrothieno[2, 3-C]pyridin-2-Yl}- 1-Naphthalenecarboxamide Length = 364 Back     alignment and structure
>pdb|1PMN|A Chain A, Crystal Structure Of Jnk3 In Complex With An Imidazole- Pyrimidine Inhibitor Length = 364 Back     alignment and structure
>pdb|3QYW|A Chain A, Crystal Structure Of Erk2 In Complex With An Inhibitor Length = 364 Back     alignment and structure
>pdb|3E92|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biaryl Amide Inhibitor Length = 371 Back     alignment and structure
>pdb|3PTG|A Chain A, Design And Synthesis Of A Novel, Orally Efficacious Tri-Substituted Thiophene Based Jnk Inhibitor Length = 363 Back     alignment and structure
>pdb|2GTM|A Chain A, Mutated Mouse P38 Map Kinase Domain In Complex With Inhibitor Pg-892579 Length = 348 Back     alignment and structure
>pdb|3P4K|A Chain A, The Third Conformation Of P38a Map Kinase Observed In Phosphorylated P38a And In Solution Length = 370 Back     alignment and structure
>pdb|1LEW|A Chain A, Crystal Structure Of Map Kinase P38 Complexed To The Docking Site On Its Nuclear Substrate Mef2a Length = 360 Back     alignment and structure
>pdb|2EXC|X Chain X, Inhibitor Complex Of Jnk3 Length = 356 Back     alignment and structure
>pdb|3TTJ|A Chain A, Crystal Structure Of Jnk3 Complexed With Cc-359, A Jnk Inhibitor For The Prevention Of Ischemia-Reperfusion Injury Length = 464 Back     alignment and structure
>pdb|2BAL|A Chain A, P38alpha Map Kinase Bound To Pyrazoloamine Length = 365 Back     alignment and structure
>pdb|4H3Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 Back     alignment and structure
>pdb|4H36|A Chain A, Crystal Structure Of Jnk3 In Complex With Atf2 Peptide Length = 356 Back     alignment and structure
>pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 Back     alignment and structure
>pdb|2PUU|A Chain A, Crystal Structure Of P38 Complex With 1-(5-Tert-Butyl-2-P- Tolyl-2h-Pyrazol-3-Yl)-3-[4-(6-Morpholin-4-Ylmethyl- Pyridin-3-Yl)naphthalen-1-Yl]urea Length = 348 Back     alignment and structure
>pdb|2B1P|A Chain A, Inhibitor Complex Of Jnk3 Length = 355 Back     alignment and structure
>pdb|2Y9Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|2OZA|B Chain B, Structure Of P38alpha Complex Length = 366 Back     alignment and structure
>pdb|1WZY|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Pyrazolopyridazine Derivative Length = 368 Back     alignment and structure
>pdb|1TVO|A Chain A, The Structure Of Erk2 In Complex With A Small Molecule Inhibitor Length = 368 Back     alignment and structure
>pdb|3ZUV|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|2ERK|A Chain A, Phosphorylated Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 Back     alignment and structure
>pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 Back     alignment and structure
>pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3O71|A Chain A, Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length = 358 Back     alignment and structure
>pdb|4FV6|A Chain A, Crystal Structure Of The Erk2 Complexed With E57 Length = 360 Back     alignment and structure
>pdb|3DT1|A Chain A, P38 Complexed With A Quinazoline Inhibitor Length = 383 Back     alignment and structure
>pdb|3KQ7|A Chain A, Structure Of Human P38alpha With N-[4-Methyl-3-(6-{[2-(1- Methylpyrrolidin-2-Yl)ethyl]amino}pyridine-3- Amido)phenyl]- 2-(Morpholin-4-Yl)pyridine-4-Carboxamide Length = 380 Back     alignment and structure
>pdb|1BL6|A Chain A, The Complex Structure Of The Map Kinase P38SB216995 Length = 379 Back     alignment and structure
>pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 Back     alignment and structure
>pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A Dihydroquinolinone Length = 366 Back     alignment and structure
>pdb|3ZU7|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|2Z7L|A Chain A, Unphosphorylated Mitogen Activated Protein Kinase Erk2 In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin 2-Yl]amino}phenyl)acetic Acid Length = 366 Back     alignment and structure
>pdb|3C9W|A Chain A, Crystal Structure Of Erk-2 With Hypothemycin Covalently Bound Length = 357 Back     alignment and structure
>pdb|2FYS|B Chain B, Crystal Structure Of Erk2 Complex With Kim Peptide Derived From Mkp3 Length = 364 Back     alignment and structure
>pdb|3NNX|A Chain A, Crystal Structure Of Phosphorylated P38 Alpha In Complex With Dp802 Length = 354 Back     alignment and structure
>pdb|1GOL|A Chain A, Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At Position 52 Length = 364 Back     alignment and structure
>pdb|1M7Q|A Chain A, Crystal Structure Of P38 Map Kinase In Complex With A Dihydroquinazolinone Inhibitor Length = 366 Back     alignment and structure
>pdb|3EB0|A Chain A, Crystal Structure Of Cgd4_240 From Cryptosporidium Parvum In Complex With Indirubin E804 Length = 383 Back     alignment and structure
>pdb|3MPT|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Pyrrole-2- Carboxamide Inhibitor Length = 371 Back     alignment and structure
>pdb|3K3J|A Chain A, P38alpha Bound To Novel Dfg-Out Compound Pf-00416121 Length = 362 Back     alignment and structure
>pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In Complex With 4-Azaindole Inhibitor Length = 372 Back     alignment and structure
>pdb|2GFS|A Chain A, P38 Kinase Crystal Structure In Complex With Ro3201195 Length = 372 Back     alignment and structure
>pdb|3ZSG|A Chain A, X-Ray Structure Of P38alpha Bound To Tak-715 Length = 362 Back     alignment and structure
>pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|3K3I|A Chain A, P38alpha Bound To Novel Dgf-Out Compound Pf-00215955 Length = 350 Back     alignment and structure
>pdb|3GCU|A Chain A, Human P38 Map Kinase In Complex With Rl48 Length = 360 Back     alignment and structure
>pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|3OD6|X Chain X, Crystal Structure Of P38alpha Y323t Active Mutant Length = 360 Back     alignment and structure
>pdb|3HEC|A Chain A, P38 In Complex With Imatinib Length = 348 Back     alignment and structure
>pdb|1IAN|A Chain A, Human P38 Map Kinase Inhibitor Complex Length = 366 Back     alignment and structure
>pdb|2LGC|A Chain A, Joint Nmr And X-Ray Refinement Reveals The Structure Of A Novel Dibenzo[a,D]cycloheptenone InhibitorP38 MAP KINASE COMPLEX IN Solution Length = 359 Back     alignment and structure
>pdb|1DI9|A Chain A, The Structure Of P38 Mitogen-Activated Protein Kinase In Complex With 4-[3-Methylsulfanylanilino]-6,7- Dimethoxyquinazoline Length = 360 Back     alignment and structure
>pdb|4EWQ|A Chain A, Human P38 Alpha Mapk In Complex With A Pyridazine Based Inhibitor Length = 383 Back     alignment and structure
>pdb|3S3I|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 349 Back     alignment and structure
>pdb|2BAJ|A Chain A, P38alpha Bound To Pyrazolourea Length = 365 Back     alignment and structure
>pdb|3HRB|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 359 Back     alignment and structure
>pdb|3HVC|A Chain A, Crystal Structure Of Human P38alpha Map Kinase Length = 362 Back     alignment and structure
>pdb|1ZZL|A Chain A, Crystal Structure Of P38 With Triazolopyridine Length = 351 Back     alignment and structure
>pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 Back     alignment and structure
>pdb|3ODZ|X Chain X, Crystal Structure Of P38alpha Y323r Active Mutant Length = 360 Back     alignment and structure
>pdb|3ODY|X Chain X, Crystal Structure Of P38alpha Y323q Active Mutant Length = 360 Back     alignment and structure
>pdb|3NNU|A Chain A, Crystal Structure Of P38 Alpha In Complex With Dp1376 Length = 354 Back     alignment and structure
>pdb|2NPQ|A Chain A, A Novel Lipid Binding Site In The P38 Alpha Map Kinase Length = 367 Back     alignment and structure
>pdb|3OEF|X Chain X, Crystal Structure Of Y323f Inactive Mutant Of P38alpha Map Kinase Length = 360 Back     alignment and structure
>pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 Back     alignment and structure
>pdb|3VUM|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M7 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 Back     alignment and structure
>pdb|2XS0|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 386 Back     alignment and structure
>pdb|3O17|A Chain A, Crystal Structure Of Jnk1-Alpha1 Isoform Length = 370 Back     alignment and structure
>pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 Back     alignment and structure
>pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 Back     alignment and structure
>pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 Back     alignment and structure
>pdb|2G01|A Chain A, Pyrazoloquinolones As Novel, Selective Jnk1 Inhibitors Length = 370 Back     alignment and structure
>pdb|3MH2|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3R63|A Chain A, Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 Back     alignment and structure
>pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580 Length = 360 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|3O8P|A Chain A, Conformational Plasticity Of P38 Map Kinase Dfg Motif Mutants In Response To Inhibitor Binding Length = 360 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|3ELJ|A Chain A, Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine Inhibitor Length = 369 Back     alignment and structure
>pdb|3GI3|A Chain A, Crystal Structure Of A N-Phenyl-N'-Naphthylurea Analog In Complex With P38 Map Kinase Length = 360 Back     alignment and structure
>pdb|3PZE|A Chain A, Jnk1 In Complex With Inhibitor Length = 358 Back     alignment and structure
>pdb|3MH0|A Chain A, Mutagenesis Of P38 Map Kinase Eshtablishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3MH1|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|4E7W|A Chain A, Structure Of Gsk3 From Ustilago Maydis Length = 394 Back     alignment and structure
>pdb|3MH3|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3RP9|A Chain A, Crystal Structure Of The Apo Mapk From Toxoplasma Gondii, 25.M01780 Or Tgme49_007820 Length = 458 Back     alignment and structure
>pdb|3OZ6|A Chain A, Crystal Structure Of Mapk From Cryptosporidium Parvum, Cgd2_1960 Length = 388 Back     alignment and structure
>pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 Back     alignment and structure
>pdb|2I6L|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 6 (Mapk6) Length = 320 Back     alignment and structure
>pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 Back     alignment and structure
>pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3N9X|A Chain A, Crystal Structure Of Map Kinase From Plasmodium Berghei, Pb000659.00.0 Length = 432 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|3NIE|A Chain A, Crystal Structure Of Pf11_0147 Length = 429 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|3E3P|A Chain A, Glycogen Synthase Kinase From Leishmania Major Length = 360 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|2F9G|A Chain A, Crystal Structure Of Fus3 Phosphorylated On Tyr182 Length = 353 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure
>pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (Erk5) With Inhibitor Length = 398 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 Kinase Domain In Complex With An Mkk5 Binding Fragment Length = 442 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|2B9F|A Chain A, Crystal Structure Of Non-Phosphorylated Fus3 Length = 353 Back     alignment and structure
>pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 Back     alignment and structure
>pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|2B9H|A Chain A, Crystal Structure Of Fus3 With A Docking Motif From Ste7 Length = 353 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 Back     alignment and structure
>pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 Back     alignment and structure
>pdb|3UIB|A Chain A, Map Kinase Lmampk10 From Leishmania Major In Complex With Sb203580 Length = 362 Back     alignment and structure
>pdb|3PG1|A Chain A, Map Kinase Lmampk10 From Leishmania Major (1.95 Angs Resolution) Length = 362 Back     alignment and structure
>pdb|3RZF|A Chain A, Crystal Structure Of Inhibitor Of Kappab Kinase Beta (I4122) Length = 677 Back     alignment and structure
>pdb|3QA8|A Chain A, Crystal Structure Of Inhibitor Of Kappa B Kinase Beta Length = 676 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|3ZDI|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide And Inhibitor 7d Length = 350 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|4AFJ|A Chain A, 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selective Gsk-3 Inhibitors Length = 367 Back     alignment and structure
>pdb|1GNG|A Chain A, Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With Frattide Peptide Length = 378 Back     alignment and structure
>pdb|3F7Z|A Chain A, X-ray Co-crystal Structure Of Glycogen Synthase Kinase 3beta In Complex With An Inhibitor Length = 350 Back     alignment and structure
>pdb|3F88|A Chain A, Glycogen Synthase Kinase 3beta Inhibitor Complex Length = 349 Back     alignment and structure
>pdb|2OW3|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With Bis- (Indole)maleimide Pyridinophane Inhibitor Length = 352 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|4DIT|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Imidazopyridine Inhibitor Length = 382 Back     alignment and structure
>pdb|3ZRK|A Chain A, Identification Of 2-(4-Pyridyl)thienopyridinones As Gsk-3beta Inhibitors Length = 371 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|3GB2|A Chain A, Gsk3beta Inhibitor Complex Length = 353 Back     alignment and structure
>pdb|1O9U|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide Length = 350 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|1UV5|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With 6-Bromoindirubin-3'-Oxime Length = 350 Back     alignment and structure
>pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 Back     alignment and structure
>pdb|3SAY|A Chain A, Crystal Structure Of Human Glycogen Synthase Kinase 3 Beta (Gsk3b) In Complex With Inhibitor 142 Length = 430 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|3SD0|A Chain A, Identification Of A Glycogen Synthase Kinase-3b Inhibitor That Attenuates Hyperactivity In Clock Mutant Mice Length = 350 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|1H8F|A Chain A, Glycogen Synthase Kinase 3 Beta. Length = 352 Back     alignment and structure
>pdb|2O5K|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Benzoimidazol Inhibitor Length = 372 Back     alignment and structure
>pdb|1R0E|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With 3-Indolyl-4- Arylmaleimide Inhibitor Length = 391 Back     alignment and structure
>pdb|4ACC|A Chain A, Gsk3b In Complex With Inhibitor Length = 465 Back     alignment and structure
>pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 Back     alignment and structure
>pdb|1Q5K|A Chain A, Crystal Structure Of Glycogen Synthase Kinase 3 In Complexed With Inhibitor Length = 414 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|1Q3D|A Chain A, Gsk-3 Beta Complexed With Staurosporine Length = 424 Back     alignment and structure
>pdb|1PYX|A Chain A, Gsk-3 Beta Complexed With Amp-Pnp Length = 422 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|1I09|A Chain A, Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Length = 420 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query329
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 1e-101
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 6e-70
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 7e-21
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 3e-66
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 3e-64
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 4e-63
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 2e-43
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 3e-17
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 4e-43
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 2e-17
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 2e-23
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 4e-05
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 6e-23
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 2e-04
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 5e-21
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 3e-20
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 5e-04
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 3e-20
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 4e-04
2fst_X367 Mitogen-activated protein kinase 14; active mutant 7e-20
2fst_X367 Mitogen-activated protein kinase 14; active mutant 2e-04
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 1e-19
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 1e-07
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 3e-19
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 5e-04
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 3e-19
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 1e-08
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 3e-19
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 5e-07
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 7e-19
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 3e-08
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 1e-18
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 4e-05
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 2e-18
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 5e-04
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 2e-18
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 8e-08
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 3e-18
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 1e-07
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 3e-18
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 2e-17
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 8e-04
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 6e-16
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 3e-08
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 8e-16
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 9e-07
3rp9_A458 Mitogen-activated protein kinase; structural genom 8e-16
3rp9_A458 Mitogen-activated protein kinase; structural genom 7e-05
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 2e-15
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 7e-05
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 2e-15
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 3e-07
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 2e-15
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 3e-08
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 3e-15
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 1e-04
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 3e-15
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 1e-10
3niz_A311 Rhodanese family protein; structural genomics, str 4e-15
3niz_A311 Rhodanese family protein; structural genomics, str 3e-07
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 5e-15
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 3e-07
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 9e-15
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 2e-08
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 1e-14
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 6e-07
3o0g_A292 Cell division protein kinase 5; kinase activator c 1e-14
3o0g_A292 Cell division protein kinase 5; kinase activator c 3e-07
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 2e-14
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 9e-07
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 3e-14
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 1e-06
3eqc_A360 Dual specificity mitogen-activated protein kinase; 3e-14
3eqc_A360 Dual specificity mitogen-activated protein kinase; 3e-10
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 4e-14
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 3e-10
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 4e-14
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-10
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 1e-13
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 3e-06
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 1e-13
3lij_A494 Calcium/calmodulin dependent protein kinase with A 1e-07
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 2e-13
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 2e-09
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 2e-13
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 8e-10
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 3e-13
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 5e-10
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 6e-13
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 1e-06
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 7e-13
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 4e-10
2a19_B284 Interferon-induced, double-stranded RNA-activated 7e-13
2a19_B284 Interferon-induced, double-stranded RNA-activated 5e-09
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 7e-13
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 1e-09
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 8e-13
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 2e-07
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 9e-13
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 1e-09
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 2e-12
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 9e-11
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 2e-12
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 4e-08
3fme_A290 Dual specificity mitogen-activated protein kinase; 5e-12
3fme_A290 Dual specificity mitogen-activated protein kinase; 3e-06
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 7e-12
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 1e-07
2dyl_A318 Dual specificity mitogen-activated protein kinase 1e-11
2dyl_A318 Dual specificity mitogen-activated protein kinase 7e-09
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 1e-11
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 3e-11
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 1e-11
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 3e-07
3aln_A327 Dual specificity mitogen-activated protein kinase; 1e-11
3aln_A327 Dual specificity mitogen-activated protein kinase; 6e-08
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 2e-11
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 2e-09
3an0_A340 Dual specificity mitogen-activated protein kinase; 2e-11
3an0_A340 Dual specificity mitogen-activated protein kinase; 3e-05
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 2e-11
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 2e-05
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 2e-11
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 5e-07
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 2e-11
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 1e-07
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 7e-11
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 3e-08
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 1e-10
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 6e-10
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 1e-10
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 2e-06
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 1e-10
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 4e-07
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 2e-10
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 3e-07
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 2e-10
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 2e-06
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 2e-10
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 3e-08
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 5e-10
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 7e-08
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 5e-10
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 8e-08
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 5e-10
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 2e-09
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 8e-10
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 1e-09
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 1e-09
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 1e-07
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 1e-09
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 4e-07
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 1e-09
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 7e-07
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 2e-09
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 4e-09
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 2e-09
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 6e-07
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 2e-09
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 3e-04
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 4e-09
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 1e-06
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 5e-09
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 1e-08
3bhy_A283 Death-associated protein kinase 3; death associate 6e-09
3bhy_A283 Death-associated protein kinase 3; death associate 1e-06
3bhy_A283 Death-associated protein kinase 3; death associate 6e-05
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 6e-09
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 2e-07
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 6e-09
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 2e-04
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 7e-09
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 2e-07
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 1e-08
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 2e-06
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 5e-05
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 1e-08
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 7e-07
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 1e-08
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 1e-04
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 8e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2y0a_A326 Death-associated protein kinase 1; transferase, ca 2e-08
2y0a_A326 Death-associated protein kinase 1; transferase, ca 2e-06
2y0a_A326 Death-associated protein kinase 1; transferase, ca 3e-05
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 2e-08
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 2e-06
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 5e-05
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 2e-08
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 6e-06
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 3e-05
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 4e-08
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 5e-05
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 4e-08
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 2e-06
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 4e-08
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 2e-04
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 6e-04
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 4e-08
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 2e-05
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 4e-08
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 9e-08
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 4e-08
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 3e-05
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 3e-05
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 5e-08
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 1e-05
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 3e-04
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 5e-08
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 4e-05
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 7e-05
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 6e-08
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-06
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-05
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 6e-08
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 1e-05
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 1e-04
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 7e-08
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 6e-07
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 7e-08
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 4e-05
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 2e-04
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 8e-08
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 9e-06
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 1e-04
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 8e-08
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 5e-06
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 6e-05
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 9e-08
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 8e-07
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 3e-05
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 1e-07
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 3e-04
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 1e-07
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 7e-07
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 8e-05
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 1e-07
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 6e-05
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 2e-04
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 1e-07
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 7e-05
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 2e-04
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 1e-07
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 4e-05
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 3e-04
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 1e-07
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 2e-05
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 2e-07
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 3e-04
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 5e-04
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 2e-07
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 3e-06
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 2e-07
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 2e-05
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 6e-04
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 2e-07
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 7e-07
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 2e-07
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 2e-07
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 2e-05
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 2e-07
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 7e-07
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 2e-05
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 3e-07
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 3e-04
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 5e-04
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 3e-07
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 4e-06
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 3e-07
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 7e-07
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 4e-07
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 2e-06
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 5e-07
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 6e-04
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 5e-07
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 2e-04
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 6e-07
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 2e-06
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 6e-07
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 3e-05
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 8e-07
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 1e-05
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 9e-07
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 9e-06
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 9e-07
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 1e-06
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 3e-04
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 1e-06
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 5e-06
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 1e-06
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 1e-05
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 1e-06
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 2e-06
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 2e-06
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 7e-06
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 2e-06
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 2e-06
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 6e-06
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 2e-06
3pvu_A695 Beta-adrenergic receptor kinase 1; transferase, se 9e-06
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 2e-06
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 2e-05
2eue_A275 Carbon catabolite derepressing protein kinase; kin 2e-06
2eue_A275 Carbon catabolite derepressing protein kinase; kin 1e-04
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 3e-06
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 2e-05
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 3e-06
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 4e-04
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 3e-06
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 9e-06
3ork_A311 Serine/threonine protein kinase; structural genomi 3e-06
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 3e-06
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 3e-06
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 1e-04
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 3e-06
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 8e-05
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 6e-06
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 6e-06
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 7e-05
3dls_A335 PAS domain-containing serine/threonine-protein KI; 6e-06
3dls_A335 PAS domain-containing serine/threonine-protein KI; 5e-05
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 8e-06
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 8e-06
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 5e-05
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 8e-06
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 8e-05
3q4u_A301 Activin receptor type-1; structural genomics conso 8e-06
3q4u_A301 Activin receptor type-1; structural genomics conso 2e-04
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 8e-06
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 2e-04
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 9e-06
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 9e-06
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 1e-05
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 4e-05
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 1e-05
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 1e-04
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 1e-05
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 1e-05
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 2e-04
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 1e-05
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 3e-05
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 2e-05
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 2e-04
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 2e-05
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 2e-05
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 3e-04
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 2e-05
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 6e-05
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 2e-05
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 2e-05
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 2e-05
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 1e-04
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 2e-05
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 6e-04
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 4e-05
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 5e-05
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 8e-05
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 5e-05
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 2e-04
3soc_A322 Activin receptor type-2A; structural genomics cons 1e-04
3uqc_A286 Probable conserved transmembrane protein; structur 1e-04
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 2e-04
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 2e-04
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 3e-04
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
 Score =  301 bits (772), Expect = e-101
 Identities = 126/298 (42%), Positives = 175/298 (58%), Gaps = 23/298 (7%)

Query: 1   MVLEFLGDSLLRLIKYSRYKGLELNKVREICKYILTGLDYLHRELGIIHTDLKPENILLV 60
           MV E LG  LL+ I  S Y+GL L  V++I + +L GLDYLH +  IIHTD+KPENILL 
Sbjct: 122 MVFEVLGHHLLKWIIKSNYQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILLS 181

Query: 61  STIDPSKDPIRSGLTPILERPEGSINGGSTSTMTIVEKKLKRRAKRAVANISIRRASMGG 120
                                E  I   +              +  AV+       +   
Sbjct: 182 V-------------------NEQYIRRLAAEATEWQRSGAPPPSGSAVSTAPATAGNFL- 221

Query: 121 IELPKPERCLDGIDMRCKVVDFGNACRANKQFAEEIQTRQYRAPEVILRAGYSFSVDMWS 180
                P    +   ++ K+ D GNAC  +K F E+IQTRQYR+ EV++ +GY+   D+WS
Sbjct: 222 ---VNPLEPKNAEKLKVKIADLGNACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWS 278

Query: 181 FACTAFELATGDMLFAPKSGQGFCEDEDHLALMMELIGKMPRKIAIGGAQSKDYFDRHGD 240
            AC AFELATGD LF P SG+ +  DEDH+AL++EL+GK+PRK+ + G  SK++F + GD
Sbjct: 279 TACMAFELATGDYLFEPHSGEEYTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGD 338

Query: 241 LKRIRRLKFWSLDRLLVDKYRFSETDAREFAEFLVPLLDFTPEKRPTAQQCLQHPWLS 298
           LK I +LK W L  +LV+KY +S+ +A  F +FL+P+L+  PEKR TA +CL+HPWL+
Sbjct: 339 LKHITKLKPWGLFEVLVEKYEWSQEEAAGFTDFLLPMLELIPEKRATAAECLRHPWLN 396


>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Length = 352 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Length = 330 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Length = 298 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Length = 364 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query329
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 100.0
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 100.0
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 100.0
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 100.0
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 100.0
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 100.0
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 100.0
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 100.0
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 100.0
3niz_A311 Rhodanese family protein; structural genomics, str 100.0
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
3rp9_A458 Mitogen-activated protein kinase; structural genom 100.0
3o0g_A292 Cell division protein kinase 5; kinase activator c 100.0
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 100.0
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 100.0
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 100.0
2fst_X367 Mitogen-activated protein kinase 14; active mutant 100.0
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 100.0
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 100.0
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 100.0
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 100.0
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 100.0
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 100.0
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 100.0
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 100.0
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 100.0
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 100.0
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 100.0
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 100.0
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 100.0
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 100.0
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 100.0
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 100.0
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 100.0
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 100.0
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 100.0
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 100.0
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 100.0
2y0a_A326 Death-associated protein kinase 1; transferase, ca 100.0
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 100.0
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 100.0
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 100.0
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 100.0
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 100.0
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 100.0
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 100.0
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 100.0
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 100.0
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 100.0
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 100.0
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 100.0
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 100.0
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 100.0
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 100.0
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 100.0
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 100.0
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 100.0
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 100.0
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 100.0
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 100.0
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 100.0
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 100.0
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 100.0
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 100.0
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 100.0
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 100.0
3eqc_A360 Dual specificity mitogen-activated protein kinase; 100.0
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 100.0
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 100.0
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 100.0
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 100.0
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 100.0
2eue_A275 Carbon catabolite derepressing protein kinase; kin 100.0
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 100.0
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 100.0
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 100.0
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 100.0
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 100.0
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 100.0
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 100.0
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 100.0
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 100.0
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 100.0
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 100.0
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 100.0
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 100.0
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 100.0
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 100.0
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.98
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.98
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.98
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.98
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.98
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.98
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.98
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.98
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.98
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.98
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.98
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.98
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.98
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.98
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.98
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.98
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.97
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.97
3bhy_A283 Death-associated protein kinase 3; death associate 99.97
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.97
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.97
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.97
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.97
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.97
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.97
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.97
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.97
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.97
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.97
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.97
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.97
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.97
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.97
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 99.97
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.97
3ork_A311 Serine/threonine protein kinase; structural genomi 99.97
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.97
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.97
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.97
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.97
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.97
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.97
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.97
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.97
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.97
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.97
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.97
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.97
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.97
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 99.97
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.97
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.97
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.97
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.97
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.97
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.97
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.97
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.97
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.97
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.97
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.97
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.96
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.96
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.96
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.96
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.96
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.96
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.96
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.96
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.96
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.96
3q4u_A301 Activin receptor type-1; structural genomics conso 99.96
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.96
3soc_A322 Activin receptor type-2A; structural genomics cons 99.96
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.96
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.96
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.96
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.96
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.96
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.96
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.96
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.96
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.96
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.96
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.96
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.96
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.96
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.96
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.96
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.96
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.96
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.96
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.96
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.96
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.96
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.96
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.96
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.96
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.96
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.96
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.96
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.96
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.96
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.96
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.96
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.96
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.96
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.96
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.96
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.96
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.96
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.96
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.96
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.96
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.96
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.96
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.96
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.96
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.96
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.96
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.96
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.96
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.96
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.96
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.96
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.95
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.95
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.95
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.95
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.95
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.95
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.95
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.95
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.95
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.94
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.93
3uqc_A286 Probable conserved transmembrane protein; structur 99.9
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.85
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.62
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.35
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.15
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 98.68
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 97.98
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 97.69
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 97.39
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 97.23
3r70_A320 Aminoglycoside phosphotransferase; structural geno 96.61
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 96.14
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 95.28
2yle_A229 Protein spire homolog 1; actin-binding protein, ac 94.48
2q83_A346 YTAA protein; 2635576, structural genomics, joint 94.07
2pyw_A420 Uncharacterized protein; 5-methylthioribose kinase 90.79
2ppq_A322 HSK, HK, homoserine kinase; structural genomics, M 86.8
1zyl_A328 Hypothetical protein YIHE; putative protein kinase 86.28
2qg7_A458 Ethanolamine kinase PV091845; malaria, SGC, struct 85.88
3csv_A333 Aminoglycoside phosphotransferase; YP_614837.1, ph 83.67
3i1a_A339 Spectinomycin phosphotransferase; protein kinase, 82.6
3ats_A357 Putative uncharacterized protein; hypothetical pro 81.82
1nw1_A429 Choline kinase (49.2 KD); phospholipid synthesis, 81.76
3ovc_A362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 81.57
3c5i_A369 Choline kinase; choline, kinase, malaria, transfer 81.48
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
Probab=100.00  E-value=6.4e-43  Score=318.25  Aligned_cols=183  Identities=28%  Similarity=0.434  Sum_probs=153.2

Q ss_pred             Cccccc-chhHHHHHHhhcCCCcchHHHHHHHHHHHHHHHHHHhhCCccccCCCCCceeeecCCCCCCCCCCCCCCCccc
Q 020240            1 MVLEFL-GDSLLRLIKYSRYKGLELNKVREICKYILTGLDYLHRELGIIHTDLKPENILLVSTIDPSKDPIRSGLTPILE   79 (329)
Q Consensus         1 lV~e~~-g~sL~~~~~~~~~~~l~~~~~~~i~~qll~al~~lH~~~giiH~Dlk~~Nil~~~~~~~~~~~~~~~~~~~~~   79 (329)
                      |||||| |++|.+++...  +.+++..++.++.||+.||+|||++ ||+||||||+|||+                    
T Consensus       109 ivmEy~~gG~L~~~i~~~--~~l~e~~~~~~~~qi~~al~ylH~~-~IiHRDlKPeNILl--------------------  165 (311)
T 4aw0_A          109 FGLSYAKNGELLKYIRKI--GSFDETCTRFYTAEIVSALEYLHGK-GIIHRDLKPENILL--------------------  165 (311)
T ss_dssp             EEECCCTTEEHHHHHHHH--SSCCHHHHHHHHHHHHHHHHHHHHT-TEECSCCSGGGEEE--------------------
T ss_pred             EEEecCCCCCHHHHHHHc--CCCCHHHHHHHHHHHHHHHHHHHHC-CCccCCCCHHHeEE--------------------
Confidence            689999 99999999876  4599999999999999999999995 99999999999999                    


Q ss_pred             CCCCCCCCCCCchhHHHHHHHHHHhhhhccchhhcccccCCccCCCCCccCCCCCCceEEeecCcccccc-----ccccc
Q 020240           80 RPEGSINGGSTSTMTIVEKKLKRRAKRAVANISIRRASMGGIELPKPERCLDGIDMRCKVVDFGNACRAN-----KQFAE  154 (329)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~Dfg~a~~~~-----~~~~~  154 (329)
                                                                          +....+||+|||+|....     .....
T Consensus       166 ----------------------------------------------------~~~g~vKl~DFGla~~~~~~~~~~~~~~  193 (311)
T 4aw0_A          166 ----------------------------------------------------NEDMHIQITDFGTAKVLSPESKQARANS  193 (311)
T ss_dssp             ----------------------------------------------------CTTSCEEECCCTTCEECCTTTTCCCBCC
T ss_pred             ----------------------------------------------------cCCCCEEEEEcCCceecCCCCCcccccC
Confidence                                                                334679999999996543     13345


Q ss_pred             CCCCCCCcchHHhhcCCCCccchHHHHHHHHHHHHhCCcCCCCCCCCCCCCchHHHHHHHHHhCCCcHHHHhcCCCCccc
Q 020240          155 EIQTRQYRAPEVILRAGYSFSVDMWSFACTAFELATGDMLFAPKSGQGFCEDEDHLALMMELIGKMPRKIAIGGAQSKDY  234 (329)
Q Consensus       155 ~~~~~~y~aPE~~~~~~~s~~~DiwslG~il~~l~~g~~pf~~~~~~~~~~~~~~l~~i~~~~g~~p~~~~~~~~~~~~~  234 (329)
                      .+||+.|+|||++.+..|+.++|||||||++|+|++|.+||.+.      +....+..|.                    
T Consensus       194 ~~GTp~YmAPEvl~~~~y~~~~DiWSlGvilyeml~G~~PF~~~------~~~~~~~~i~--------------------  247 (311)
T 4aw0_A          194 FVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAG------NEGLIFAKII--------------------  247 (311)
T ss_dssp             CCSCGGGCCHHHHHHSCBCHHHHHHHHHHHHHHHHHSSCSSCCS------SHHHHHHHHH--------------------
T ss_pred             cccCcccCCHHHHcCCCCCcHHHHHHHHHHHHHHHhCCCCCCCC------CHHHHHHHHH--------------------
Confidence            68999999999999999999999999999999999999999765      2333333332                    


Q ss_pred             cCccCchhhhccccccchhHHHhhhcCCChhhHHHHHHHHhhccCCCCCCCcCHHH------HhcCCCcCCCCCChhh
Q 020240          235 FDRHGDLKRIRRLKFWSLDRLLVDKYRFSETDAREFAEFLVPLLDFTPEKRPTAQQ------CLQHPWLSLRNSTRDE  306 (329)
Q Consensus       235 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dll~~~L~~dP~~R~ta~e------ll~hpwf~~~~~~~~~  306 (329)
                                            ...+.++...+.++.+||++||+.||++|+|+.|      |++||||++++|..-.
T Consensus       248 ----------------------~~~~~~p~~~s~~~~dli~~lL~~dp~~R~t~~e~~~~~~i~~Hp~F~~idw~~l~  303 (311)
T 4aw0_A          248 ----------------------KLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLH  303 (311)
T ss_dssp             ----------------------HTCCCCCTTCCHHHHHHHHHHSCSSGGGSTTSGGGTCHHHHHTSGGGTTCCCTTGG
T ss_pred             ----------------------cCCCCCCcccCHHHHHHHHHHccCCHhHCcChHHHcCCHHHHCCCCcCCCCHHHhc
Confidence                                  2222344445678999999999999999999988      5899999999987543



>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>2yle_A Protein spire homolog 1; actin-binding protein, actin polymerization; 1.80A {Homo sapiens} PDB: 2ylf_A 3r7g_A 3rbw_A Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure
>1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 Back     alignment and structure
>2qg7_A Ethanolamine kinase PV091845; malaria, SGC, structural genomics consortium, transferase; 2.41A {Plasmodium vivax} Back     alignment and structure
>3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>1nw1_A Choline kinase (49.2 KD); phospholipid synthesis, protein kinase fold, transferase; 2.02A {Caenorhabditis elegans} SCOP: d.144.1.8 Back     alignment and structure
>3c5i_A Choline kinase; choline, kinase, malaria, transferase, structural genomics, structural genomics consortium; 2.20A {Plasmodium knowlesi} PDB: 3fi8_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 329
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 1e-37
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 3e-08
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 9e-26
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 3e-11
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 2e-22
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 9e-05
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 1e-21
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 8e-21
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 2e-09
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 2e-20
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 1e-05
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 2e-20
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 2e-06
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 2e-20
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 5e-04
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 4e-20
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 9e-20
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 2e-08
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 1e-19
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 4e-05
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 1e-19
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 0.002
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 9e-19
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 2e-05
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 2e-18
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 7e-08
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 4e-18
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 2e-07
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 1e-17
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 7e-09
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 5e-17
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 4e-07
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 1e-16
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 9e-12
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 1e-16
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 4e-07
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 2e-16
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 8e-09
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 1e-15
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 0.003
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-14
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-10
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 3e-14
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 5e-08
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 3e-14
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 4e-08
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 4e-14
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 7e-05
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 4e-14
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 5e-04
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 5e-14
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 3e-09
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 1e-13
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 3e-09
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-13
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 9e-07
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 4e-13
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 5e-07
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 1e-12
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 2e-09
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 2e-12
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 6e-08
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 2e-12
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 2e-06
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 3e-12
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 6e-05
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 3e-11
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 6e-04
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 2e-10
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 5e-08
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 6e-10
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 7e-07
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 1e-09
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 6e-05
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 1e-09
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 6e-07
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-09
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-06
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 2e-09
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 2e-05
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 2e-09
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 1e-07
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 5e-09
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 1e-05
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 1e-08
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 2e-05
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 1e-08
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 4e-07
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 1e-08
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 7e-05
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 3e-08
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-05
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 4e-08
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 0.003
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 5e-08
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 2e-04
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 1e-07
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 3e-05
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 3e-07
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 2e-06
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 4e-07
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 5e-04
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 7e-07
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 8e-06
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 1e-06
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 3e-04
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 1e-06
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-05
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 1e-06
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 2e-05
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 2e-06
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 1e-05
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 2e-06
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 5e-04
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 2e-06
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 3e-06
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 3e-06
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 2e-04
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 1e-05
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 4e-05
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 9e-05
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 0.002
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 0.001
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Sky1p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score =  135 bits (341), Expect = 1e-37
 Identities = 73/179 (40%), Positives = 111/179 (62%), Gaps = 6/179 (3%)

Query: 125 KPERCL------DGIDMRCKVVDFGNACRANKQFAEEIQTRQYRAPEVILRAGYSFSVDM 178
           KPE  L          ++ K+ D GNAC  ++ +   IQTR+YR+PEV+L A +    D+
Sbjct: 153 KPENVLMEIVDSPENLIQIKIADLGNACWYDEHYTNSIQTREYRSPEVLLGAPWGCGADI 212

Query: 179 WSFACTAFELATGDMLFAPKSGQGFCEDEDHLALMMELIGKMPRKIAIGGAQSKDYFDRH 238
           WS AC  FEL TGD LF P  G  + +D+DH+A ++EL+G++P  +   G  ++ +F+  
Sbjct: 213 WSTACLIFELITGDFLFEPDEGHSYTKDDDHIAQIIELLGELPSYLLRNGKYTRTFFNSR 272

Query: 239 GDLKRIRRLKFWSLDRLLVDKYRFSETDAREFAEFLVPLLDFTPEKRPTAQQCLQHPWL 297
           G L+ I +LKFW L+ +L +KY+FS+ +A+E ++FL P+L   P KR  A   + HPWL
Sbjct: 273 GLLRNISKLKFWPLEDVLTEKYKFSKDEAKEISDFLSPMLQLDPRKRADAGGLVNHPWL 331


>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query329
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.98
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.97
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.97
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.97
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.97
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.97
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.97
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.39
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 91.96
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 85.34
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 84.65
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 84.13
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 81.22
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cyclin-dependent PK, CDK6
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.5e-40  Score=301.26  Aligned_cols=208  Identities=27%  Similarity=0.455  Sum_probs=162.7

Q ss_pred             CcccccchhHHHHHHhhcCCCcchHHHHHHHHHHHHHHHHHHhhCCccccCCCCCceeeecCCCCCCCCCCCCCCCcccC
Q 020240            1 MVLEFLGDSLLRLIKYSRYKGLELNKVREICKYILTGLDYLHRELGIIHTDLKPENILLVSTIDPSKDPIRSGLTPILER   80 (329)
Q Consensus         1 lV~e~~g~sL~~~~~~~~~~~l~~~~~~~i~~qll~al~~lH~~~giiH~Dlk~~Nil~~~~~~~~~~~~~~~~~~~~~~   80 (329)
                      ++||+|++.+..+........+++..++.++.||+.||+|||++ ||+||||||+|||+.                    
T Consensus        92 ~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~qi~~aL~yLH~~-~ivHrDiKp~NILi~--------------------  150 (305)
T d1blxa_          92 LVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSH-RVVHRDLKPQNILVT--------------------  150 (305)
T ss_dssp             EEEECCSCBHHHHHHHSCTTCSCHHHHHHHHHHHHHHHHHHHHT-TCCCCCCCGGGEEEC--------------------
T ss_pred             EEEEeccCCchhhhhhccCCCCCHHHHHHHHHHHHHHHHHHHhC-CEEecCCCccEEEEc--------------------
Confidence            57999955545455544556799999999999999999999995 999999999999993                    


Q ss_pred             CCCCCCCCCCchhHHHHHHHHHHhhhhccchhhcccccCCccCCCCCccCCCCCCceEEeecCcccccc--cccccCCCC
Q 020240           81 PEGSINGGSTSTMTIVEKKLKRRAKRAVANISIRRASMGGIELPKPERCLDGIDMRCKVVDFGNACRAN--KQFAEEIQT  158 (329)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~Dfg~a~~~~--~~~~~~~~~  158 (329)
                                                                          ....++|+|||.+....  .......||
T Consensus       151 ----------------------------------------------------~~~~~kl~dfg~~~~~~~~~~~~~~~gT  178 (305)
T d1blxa_         151 ----------------------------------------------------SSGQIKLADFGLARIYSFQMALTSVVVT  178 (305)
T ss_dssp             ----------------------------------------------------TTCCEEECSCCSCCCCCGGGGGCCCCCC
T ss_pred             ----------------------------------------------------CCCCeeecchhhhhhhcccccCCCcccC
Confidence                                                                34579999999985443  344567899


Q ss_pred             CCCcchHHhhcCCCCccchHHHHHHHHHHHHhCCcCCCCCCCCCCCCchHHHHHHHHHhCCCcHHHHhcCCCC-ccccCc
Q 020240          159 RQYRAPEVILRAGYSFSVDMWSFACTAFELATGDMLFAPKSGQGFCEDEDHLALMMELIGKMPRKIAIGGAQS-KDYFDR  237 (329)
Q Consensus       159 ~~y~aPE~~~~~~~s~~~DiwslG~il~~l~~g~~pf~~~~~~~~~~~~~~l~~i~~~~g~~p~~~~~~~~~~-~~~~~~  237 (329)
                      +.|+|||++.+.+|+.++||||+||++|+|++|.+||.+.      +..+++..|.+.+|.++...+...... ...+..
T Consensus       179 ~~Y~APE~~~~~~y~~~~DiwSlG~il~ell~g~~pf~~~------~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~  252 (305)
T d1blxa_         179 LWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGS------SDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHS  252 (305)
T ss_dssp             CTTCCHHHHTTCCCCTHHHHHHHHHHHHHHHHSSCSCCCS------SHHHHHHHHHHHHCCCCGGGSCTTCSSCGGGSCC
T ss_pred             hhhcCcchhcCCCCChhehhhchHHHHHHHHHCCCCCCCC------CHHHHHHHHHHhhCCCchhcccccccchhhhhcc
Confidence            9999999999999999999999999999999999999876      578899999999998776554322211 111111


Q ss_pred             cCchhhhccccccchhHHHhhhcCCChhhHHHHHHHHhhccCCCCCCCcCHHHHhcCCCcCCCCCC
Q 020240          238 HGDLKRIRRLKFWSLDRLLVDKYRFSETDAREFAEFLVPLLDFTPEKRPTAQQCLQHPWLSLRNST  303 (329)
Q Consensus       238 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dll~~~L~~dP~~R~ta~ell~hpwf~~~~~~  303 (329)
                      ....         ..       .......+..+.+||++||++||++||||+|+|+||||+++...
T Consensus       253 ~~~~---------~~-------~~~~~~~s~~~~dli~~mL~~dP~~R~sa~e~L~Hpff~~i~~~  302 (305)
T d1blxa_         253 KSAQ---------PI-------EKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERC  302 (305)
T ss_dssp             CCCC---------CG-------GGTCCSCCHHHHHHHHHHSCSSTTTSCCHHHHHTSGGGTTCCCC
T ss_pred             cccc---------ch-------hhccccCCHHHHHHHHHHCcCChhHCcCHHHHhcChhhcCchhh
Confidence            1000         00       01223346789999999999999999999999999999988654



>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure