Citrus Sinensis ID: 020273


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MLQNLETNAAAGARPNNCWVESIRASSPTHMKSITPSLLEEKRAWIIRHPSALDMFHEITEASKGKQIVMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQLAKYFPTAIVTGRCRDKVYDFVKLAELYYAGSHGMDIKGPTKGLKYNQKSKVVNFQPASEFLPLIDKVYKVLVEKTKSTPGARVENNKFCISVHFRCVDEKKWNDLAQKVKEVVNEYPQLNWRQGRMVMEIRPKIEWDKGKALEFLLECLGFADCSNVFPVYIGDDTTDEDAFKILRKREQGFGILVSKFPKKTSASYSLREPDEVMDFLQKLVRWKRDSADTTKSKV
cccccHHHHHccccccccHHHHHHccccccHHHccccHHHHHHHHHHccccccccHHHHHHHHccccEEEEEEccccccccccccccccccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHccccccEEEccccEEccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccEEEEccEEEEEEcccccHHHHHHHHHHHHHHHHHccccEEEcccEEEEEEccccccHHHHHHHHHHHccccccccccEEEEccccccHHHHHHHHHccccEEEEEcccccccccEEEcccHHHHHHHHHHHHHHHHcccccccccc
cHHHHHHHcccccccHHHHHHHHHHccccccccccccccHHHHHHHHHcccHHcHHHHHHHHHccccEEEEEEccccccccccccHcccccHHHHHHHHHHHHcccEEEEEcccHHHHHHHcccHHHEEEcccccEEccccccccccccccEEccccHHHHHHHHHHHHHHHHHHHHcccccEEEccEEEEEEEEccccHHHHHHHHHHHHHHHHccccEEEEccEEEEEEEcEEcccHHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHHHcccEEEEEEccccccccEEEEcccHHHHHHHHHHHHHHcccccccccccc
MLQNLEtnaaagarpnncwvesirasspthmksitpSLLEEKRAWIIRHPSALDMFHEITEASKGKQIVMFLdydgtlspivenpdrafmsGKMRRAVRQLAKYfptaivtgrcrdkVYDFVKLAELYYagshgmdikgptkglkynqkskvvnfqpaseflpLIDKVYKVLVEKtkstpgarvennkfciSVHFRCVDEKKWNDLAQKVKEVVNEYpqlnwrqgrmvmeirpkiewdkGKALEFLLEClgfadcsnvfpvyigddttdEDAFKILRKREQGFGIlvskfpkktsasyslrepdEVMDFLQKLVRWKrdsadttkskv
MLQNLETNaaagarpnncWVESirasspthmksiTPSLLEEKRAWIIRHPSALDMFHEITEASKGKQIVMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQLAKyfptaivtgrcrdKVYDFVKLAELYYAGSHGMDIKGPTKGLKYNQKSKVVNfqpaseflpLIDKVYKVLVEKtkstpgarvennkfCISVHFRCVDEKKWNDLAQKVKEVVneypqlnwrqgrmvMEIRPKIEWDKGKALEFLLECLGFADCSNVFPVYIGDDTTDEDAFKILRKReqgfgilvskfpkktsasyslrepdevMDFLQKLVrwkrdsadttkskv
MLQNLETNAAAGARPNNCWVESIRASSPTHMKSITPSLLEEKRAWIIRHPSALDMFHEITEASKGKQIVMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQLAKYFPTAIVTGRCRDKVYDFVKLAELYYAGSHGMDIKGPTKGLKYNQKSKVVNFQPASEFLPLIDKVYKVLVEKTKSTPGARVENNKFCISVHFRCVDEKKWNDLAQKVKEVVNEYPQLNWRQGRMVMEIRPKIEWDKGKALEFLLECLGFADCSNVFPVYIGDDTTDEDAFKILRKREQGFGILVSKFPKKTSASYSLREPDEVMDFLQKLVRWKRDSADTTKSKV
*****************CWVE****************LLEEKRAWIIRHPSALDMFHEITEASKGKQIVMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQLAKYFPTAIVTGRCRDKVYDFVKLAELYY**********************VVNFQPASEFLPLIDKVYKVLVEKTKSTPGARVENNKFCISVHFRCVDEKKWNDLAQKVKEVVNEYPQLNWRQGRMVMEIRPKIEWDKGKALEFLLECLGFADCSNVFPVYIGDDTTDEDAFKILRKREQGFGILVSKFP**************VMDFLQKLVRW************
************ARPNNCWVESIRASS*************************LDMFHEITEASKGKQIVMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQLAKYFPTAIVTGRCRDKVYDFVKLAELYYAGSHGMDIKGPTKGLKYNQKSKVVNFQPASEFLPLIDKVYKVLVEKTKSTPGARVENNKFCISVHFRCVDEKKWNDLAQKVKEVVNEYPQLNWRQGRMVMEIRPKIEWDKGKALEFLLECLGFADCSNVFPVYIGDDTTDEDAFKILRKREQGFGILVSKFPKKTSASYSLREPDEVMDFLQKL***************
MLQNLETNAAAGARPNNCWVESIRASSPTHMKSITPSLLEEKRAWIIRHPSALDMFHEITEASKGKQIVMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQLAKYFPTAIVTGRCRDKVYDFVKLAELYYAGSHGMDIKGPTKGLKYNQKSKVVNFQPASEFLPLIDKVYKVLVEKTKSTPGARVENNKFCISVHFRCVDEKKWNDLAQKVKEVVNEYPQLNWRQGRMVMEIRPKIEWDKGKALEFLLECLGFADCSNVFPVYIGDDTTDEDAFKILRKREQGFGILVSKFPKKTSASYSLREPDEVMDFLQKLVRWK***********
MLQNLETNAAAGARPNNCWVE*IRA***********SLLEEKRAWIIRHPSALDMFHEITEASKGKQIVMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQLAKYFPTAIVTGRCRDKVYDFVKLAELYYAGSHGMDIKGPTKGLKYNQKSKVVNFQPASEFLPLIDKVYKVLVEKTKSTPGARVENNKFCISVHFRCVDEKKWNDLAQKVKEVVNEYPQLNWRQGRMVMEIRPKIEWDKGKALEFLLECLGFADCSNVFPVYIGDDTTDEDAFKILRKREQGFGILVSKFPKKTSASYSLREPDEVMDFLQKLVRWK***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLQNLETNAAAGARPNNCWVESIRASSPTHMKSITPSLLEEKRAWIIRHPSALDMFHEITEASKGKQIVMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQLAKYFPTAIVTGRCRDKVYDFVKLAELYYAGSHGMDIKGPTKGLKYNQKSKVVNFQPASEFLPLIDKVYKVLVEKTKSTPGARVENNKFCISVHFRCVDEKKWNDLAQKVKEVVNEYPQLNWRQGRMVMEIRPKIEWDKGKALEFLLECLGFADCSNVFPVYIGDDTTDEDAFKILRKREQGFGILVSKFPKKTSASYSLREPDEVMDFLQKLVRWKRDSADTTKSKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query328 2.2.26 [Sep-21-2011]
Q5HZ05370 Probable trehalose-phosph yes no 0.969 0.859 0.7 1e-130
Q8GWG2349 Probable trehalose-phosph no no 0.945 0.888 0.681 1e-127
F4KFG5369 Probable trehalose-phosph no no 0.966 0.859 0.666 1e-127
Q6ZAL2370 Probable trehalose-phosph yes no 0.960 0.851 0.676 1e-125
Q6H5L4375 Probable trehalose-phosph no no 0.942 0.824 0.669 1e-120
Q6ZGP8367 Probable trehalose-phosph no no 0.911 0.814 0.673 1e-120
Q67X99354 Probable trehalose-phosph no no 0.948 0.878 0.644 1e-119
Q67XC9369 Probable trehalose-phosph no no 0.926 0.823 0.658 1e-116
Q9C9S4374 Trehalose-phosphate phosp no no 0.969 0.850 0.585 1e-107
Q0DDI1 500 Probable trehalose-phosph no no 0.875 0.574 0.637 1e-103
>sp|Q5HZ05|TPPJ_ARATH Probable trehalose-phosphate phosphatase J OS=Arabidopsis thaliana GN=TPPJ PE=1 SV=1 Back     alignment and function desciption
 Score =  464 bits (1194), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 224/320 (70%), Positives = 267/320 (83%), Gaps = 2/320 (0%)

Query: 1   MLQNLETNAAAGARPNNCWVESIRASSPTHMKSITPSLLEEKRA-WIIRHPSALDMFHEI 59
           +L+NLE N A  ++  N WV+S+RASSPTH+KS++    EE+   WI RHPSAL+MF  I
Sbjct: 48  LLKNLEINGADQSQRLNSWVDSMRASSPTHLKSLSSFSSEEEHNSWIKRHPSALNMFERI 107

Query: 60  TEASKGKQIVMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQLAKYFPTAIVTGRCRDKVY 119
            E ++GKQIVMFLDYDGTLSPIV++PDRAFM+ KMRR V+++AK FPT+IVTGRC DKVY
Sbjct: 108 IEEARGKQIVMFLDYDGTLSPIVDDPDRAFMTSKMRRTVKKMAKCFPTSIVTGRCIDKVY 167

Query: 120 DFVKLAELYYAGSHGMDIKGPTKGL-KYNQKSKVVNFQPASEFLPLIDKVYKVLVEKTKS 178
            FVKLAELYYAGSHGMDIKGPTKG  +YN+    V +QPA +FLP+ID+VYK LVEKTKS
Sbjct: 168 SFVKLAELYYAGSHGMDIKGPTKGFSRYNKDKPSVLYQPAGDFLPMIDEVYKQLVEKTKS 227

Query: 179 TPGARVENNKFCISVHFRCVDEKKWNDLAQKVKEVVNEYPQLNWRQGRMVMEIRPKIEWD 238
           TPGA+VENNKFC+SVHFRCVDEKKW++LA KV+ VV  YP L   QGR V EIRP I+W+
Sbjct: 228 TPGAKVENNKFCLSVHFRCVDEKKWSELASKVRSVVKNYPTLKLSQGRKVFEIRPIIKWN 287

Query: 239 KGKALEFLLECLGFADCSNVFPVYIGDDTTDEDAFKILRKREQGFGILVSKFPKKTSASY 298
           KGKALEFLLE LGF +C++VFP+YIGDD TDEDAFK+LR R QGFGILVSKFPK TSASY
Sbjct: 288 KGKALEFLLESLGFENCNDVFPIYIGDDKTDEDAFKLLRGRGQGFGILVSKFPKDTSASY 347

Query: 299 SLREPDEVMDFLQKLVRWKR 318
           SL++P EVM+FL +LV WK+
Sbjct: 348 SLQDPPEVMNFLGRLVEWKQ 367




Removes the phosphate from trehalose 6-phosphate to produce free trehalose. Trehalose accumulation in plant may improve abiotic stress tolerance.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 2
>sp|Q8GWG2|TPPH_ARATH Probable trehalose-phosphate phosphatase H OS=Arabidopsis thaliana GN=TPPH PE=2 SV=1 Back     alignment and function description
>sp|F4KFG5|TPPI_ARATH Probable trehalose-phosphate phosphatase I OS=Arabidopsis thaliana GN=TPPI PE=2 SV=1 Back     alignment and function description
>sp|Q6ZAL2|TPP6_ORYSJ Probable trehalose-phosphate phosphatase 6 OS=Oryza sativa subsp. japonica GN=TPP6 PE=2 SV=1 Back     alignment and function description
>sp|Q6H5L4|TPP7_ORYSJ Probable trehalose-phosphate phosphatase 7 OS=Oryza sativa subsp. japonica GN=TPP7 PE=2 SV=2 Back     alignment and function description
>sp|Q6ZGP8|TPP4_ORYSJ Probable trehalose-phosphate phosphatase 4 OS=Oryza sativa subsp. japonica GN=TPP4 PE=2 SV=1 Back     alignment and function description
>sp|Q67X99|TPPE_ARATH Probable trehalose-phosphate phosphatase E OS=Arabidopsis thaliana GN=TPPE PE=2 SV=1 Back     alignment and function description
>sp|Q67XC9|TPPD_ARATH Probable trehalose-phosphate phosphatase D OS=Arabidopsis thaliana GN=TPPD PE=2 SV=1 Back     alignment and function description
>sp|Q9C9S4|TPPB_ARATH Trehalose-phosphate phosphatase B OS=Arabidopsis thaliana GN=TPPB PE=1 SV=1 Back     alignment and function description
>sp|Q0DDI1|TPP8_ORYSJ Probable trehalose-phosphate phosphatase 8 OS=Oryza sativa subsp. japonica GN=TPP8 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query328
255584858373 trehalose-6-phosphate synthase, putative 0.963 0.847 0.740 1e-139
224083713373 predicted protein [Populus trichocarpa] 0.957 0.841 0.732 1e-137
224096201374 predicted protein [Populus trichocarpa] 0.957 0.839 0.726 1e-136
356540303361 PREDICTED: trehalose-phosphate phosphata 0.963 0.875 0.728 1e-135
356569249363 PREDICTED: trehalose-phosphate phosphata 0.960 0.867 0.728 1e-134
225439022365 PREDICTED: trehalose-phosphate phosphata 0.960 0.863 0.716 1e-134
356528483366 PREDICTED: trehalose-phosphate phosphata 0.987 0.885 0.709 1e-132
356511103362 PREDICTED: trehalose-phosphate phosphata 0.969 0.878 0.709 1e-132
297797533369 hypothetical protein ARALYDRAFT_919840 [ 0.966 0.859 0.709 1e-129
449458269381 PREDICTED: probable trehalose-phosphate 0.920 0.792 0.717 1e-129
>gi|255584858|ref|XP_002533145.1| trehalose-6-phosphate synthase, putative [Ricinus communis] gi|223527056|gb|EEF29241.1| trehalose-6-phosphate synthase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  500 bits (1287), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 237/320 (74%), Positives = 279/320 (87%), Gaps = 4/320 (1%)

Query: 1   MLQNLETNAAAGARPNNCWVESIRASSPTHMKSITPSLLEEKRAWIIRHPSALDMFHEIT 60
           +L+NLE N   GAR  N WV+S+RASSPTH+KS TPSL E++ +W + HPSALDMF +I 
Sbjct: 51  LLKNLEING--GAR-INAWVDSMRASSPTHLKS-TPSLTEDQGSWTLHHPSALDMFEQII 106

Query: 61  EASKGKQIVMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQLAKYFPTAIVTGRCRDKVYD 120
           +ASKGKQIVMFLDYDGTLSPIV++PDRAFMS KMR  VR+LAK FPTAIV+GRCRDKVY+
Sbjct: 107 DASKGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRATVRKLAKCFPTAIVSGRCRDKVYN 166

Query: 121 FVKLAELYYAGSHGMDIKGPTKGLKYNQKSKVVNFQPASEFLPLIDKVYKVLVEKTKSTP 180
           FV+LAELYYAGSHGMDIKGP KG KY + S+ + FQPASEFLP+ID+VYK LVEKTKSTP
Sbjct: 167 FVRLAELYYAGSHGMDIKGPAKGSKYKKGSEALIFQPASEFLPMIDEVYKELVEKTKSTP 226

Query: 181 GARVENNKFCISVHFRCVDEKKWNDLAQKVKEVVNEYPQLNWRQGRMVMEIRPKIEWDKG 240
           GA VENNKFC+SVH+RCVDEKKW++LAQ V+ V+ +YP+L   QGR V+EIRP I+WDKG
Sbjct: 227 GAFVENNKFCVSVHYRCVDEKKWSELAQVVRSVLKDYPKLRLTQGRKVLEIRPTIKWDKG 286

Query: 241 KALEFLLECLGFADCSNVFPVYIGDDTTDEDAFKILRKREQGFGILVSKFPKKTSASYSL 300
           KALEFLLE LGF +C++VFPVYIGDD TDEDAFK+LR+R QGFGILVSKFPK TSASYSL
Sbjct: 287 KALEFLLEALGFGNCTDVFPVYIGDDRTDEDAFKVLRERGQGFGILVSKFPKDTSASYSL 346

Query: 301 REPDEVMDFLQKLVRWKRDS 320
           +EP +VMDFLQ+LV WK++S
Sbjct: 347 QEPTQVMDFLQRLVEWKKES 366




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224083713|ref|XP_002307096.1| predicted protein [Populus trichocarpa] gi|118484760|gb|ABK94249.1| unknown [Populus trichocarpa] gi|222856545|gb|EEE94092.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224096201|ref|XP_002310573.1| predicted protein [Populus trichocarpa] gi|222853476|gb|EEE91023.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356540303|ref|XP_003538629.1| PREDICTED: trehalose-phosphate phosphatase-like [Glycine max] Back     alignment and taxonomy information
>gi|356569249|ref|XP_003552816.1| PREDICTED: trehalose-phosphate phosphatase-like [Glycine max] Back     alignment and taxonomy information
>gi|225439022|ref|XP_002263078.1| PREDICTED: trehalose-phosphate phosphatase [Vitis vinifera] gi|296090615|emb|CBI40999.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356528483|ref|XP_003532832.1| PREDICTED: trehalose-phosphate phosphatase-like [Glycine max] Back     alignment and taxonomy information
>gi|356511103|ref|XP_003524269.1| PREDICTED: trehalose-phosphate phosphatase-like [Glycine max] Back     alignment and taxonomy information
>gi|297797533|ref|XP_002866651.1| hypothetical protein ARALYDRAFT_919840 [Arabidopsis lyrata subsp. lyrata] gi|297312486|gb|EFH42910.1| hypothetical protein ARALYDRAFT_919840 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449458269|ref|XP_004146870.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Cucumis sativus] gi|449521072|ref|XP_004167555.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query328
TAIR|locus:2171850370 TPPJ "trehalose-6-phosphate ph 0.969 0.859 0.703 1.2e-120
TAIR|locus:2184063369 TPPI "trehalose-6-phosphate ph 0.966 0.859 0.666 1.2e-115
TAIR|locus:2135272349 TPPH "trehalose-6-phosphate ph 0.945 0.888 0.684 8.2e-115
TAIR|locus:2060390354 TPPE "trehalose-6-phosphate ph 0.948 0.878 0.644 2.4e-108
TAIR|locus:2007651369 TPPD "trehalose-6-phosphate ph 0.969 0.861 0.638 1.7e-107
TAIR|locus:2194704374 TPPB "trehalose-6-phosphate ph 0.969 0.850 0.585 6.6e-97
TAIR|locus:2015051320 TPPC "trehalose-6-phosphate ph 0.911 0.934 0.571 5.1e-90
UNIPROTKB|Q75WV3371 TPP1 "Probable trehalose-phosp 0.926 0.819 0.555 5.3e-88
TAIR|locus:2135540368 TPPF "trehalose-6-phosphate ph 0.942 0.839 0.526 7.7e-87
TAIR|locus:2153082385 ATTPPA [Arabidopsis thaliana ( 0.923 0.787 0.546 7.7e-87
TAIR|locus:2171850 TPPJ "trehalose-6-phosphate phosphatase J" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1187 (422.9 bits), Expect = 1.2e-120, P = 1.2e-120
 Identities = 225/320 (70%), Positives = 268/320 (83%)

Query:     1 MLQNLETNAAAGARPNNCWVESIRASSPTHMKSITP-SLLEEKRAWIIRHPSALDMFHEI 59
             +L+NLE N A  ++  N WV+S+RASSPTH+KS++  S  EE  +WI RHPSAL+MF  I
Sbjct:    48 LLKNLEINGADQSQRLNSWVDSMRASSPTHLKSLSSFSSEEEHNSWIKRHPSALNMFERI 107

Query:    60 TEASKGKQIVMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQLAKYFPTAIVTGRCRDKVY 119
              E ++GKQIVMFLDYDGTLSPIV++PDRAFM+ KMRR V+++AK FPT+IVTGRC DKVY
Sbjct:   108 IEEARGKQIVMFLDYDGTLSPIVDDPDRAFMTSKMRRTVKKMAKCFPTSIVTGRCIDKVY 167

Query:   120 DFVKLAELYYAGSHGMDIKGPTKGL-KYNQKSKVVNFQPASEFLPLIDKVYKVLVEKTKS 178
              FVKLAELYYAGSHGMDIKGPTKG  +YN+    V +QPA +FLP+ID+VYK LVEKTKS
Sbjct:   168 SFVKLAELYYAGSHGMDIKGPTKGFSRYNKDKPSVLYQPAGDFLPMIDEVYKQLVEKTKS 227

Query:   179 TPGARVENNKFCISVHFRCVDEKKWNDLAQKVKEVVNEYPQLNWRQGRMVMEIRPKIEWD 238
             TPGA+VENNKFC+SVHFRCVDEKKW++LA KV+ VV  YP L   QGR V EIRP I+W+
Sbjct:   228 TPGAKVENNKFCLSVHFRCVDEKKWSELASKVRSVVKNYPTLKLSQGRKVFEIRPIIKWN 287

Query:   239 KGKALEFLLECLGFADCSNVFPVYIGDDTTDEDAFKILRKREQGFGILVSKFPKKTSASY 298
             KGKALEFLLE LGF +C++VFP+YIGDD TDEDAFK+LR R QGFGILVSKFPK TSASY
Sbjct:   288 KGKALEFLLESLGFENCNDVFPIYIGDDKTDEDAFKLLRGRGQGFGILVSKFPKDTSASY 347

Query:   299 SLREPDEVMDFLQKLVRWKR 318
             SL++P EVM+FL +LV WK+
Sbjct:   348 SLQDPPEVMNFLGRLVEWKQ 367




GO:0003824 "catalytic activity" evidence=IEA
GO:0004805 "trehalose-phosphatase activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0005737 "cytoplasm" evidence=ISM
GO:0005992 "trehalose biosynthetic process" evidence=IEA;ISS
GO:0008152 "metabolic process" evidence=IEA
GO:0046686 "response to cadmium ion" evidence=IEP
TAIR|locus:2184063 TPPI "trehalose-6-phosphate phosphatase I" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135272 TPPH "trehalose-6-phosphate phosphatase H" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060390 TPPE "trehalose-6-phosphate phosphatase E" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2007651 TPPD "trehalose-6-phosphate phosphatase D" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2194704 TPPB "trehalose-6-phosphate phosphatase B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015051 TPPC "trehalose-6-phosphate phosphatase C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q75WV3 TPP1 "Probable trehalose-phosphate phosphatase 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2135540 TPPF "trehalose-6-phosphate phosphatase F" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153082 ATTPPA [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6ZAL2TPP6_ORYSJ3, ., 1, ., 3, ., 1, 20.67600.96030.8513yesno
Q5HZ05TPPJ_ARATH3, ., 1, ., 3, ., 1, 20.70.96950.8594yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
grail3.0026014501
SubName- Full=Putative uncharacterized protein; (373 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.IV.2527.1
trehalose-6-phosphate synthase (769 aa)
      0.510
estExt_Genewise1_v1.C_290287
hypothetical protein (662 aa)
       0.503
estExt_fgenesh4_pg.C_1680018
hypothetical protein (922 aa)
       0.502

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query328
PLN03017366 PLN03017, PLN03017, trehalose-phosphatase 1e-175
PLN02151354 PLN02151, PLN02151, trehalose-phosphatase 1e-168
PLN02580384 PLN02580, PLN02580, trehalose-phosphatase 1e-152
pfam02358235 pfam02358, Trehalose_PPase, Trehalose-phosphatase 3e-73
COG1877266 COG1877, OtsB, Trehalose-6-phosphatase [Carbohydra 2e-43
TIGR00685244 TIGR00685, T6PP, trehalose-phosphatase 1e-41
PRK14501726 PRK14501, PRK14501, putative bifunctional trehalos 3e-36
PRK10187266 PRK10187, PRK10187, trehalose-6-phosphate phosphat 1e-17
TIGR01484204 TIGR01484, HAD-SF-IIB, HAD-superfamily hydrolase, 2e-16
PLN02205854 PLN02205, PLN02205, alpha,alpha-trehalose-phosphat 7e-06
TIGR01482225 TIGR01482, SPP-subfamily, sucrose-phosphate phosph 3e-04
COG0561264 COG0561, Cof, Predicted hydrolases of the HAD supe 7e-04
PRK01158230 PRK01158, PRK01158, phosphoglycolate phosphatase; 0.002
>gnl|CDD|178591 PLN03017, PLN03017, trehalose-phosphatase Back     alignment and domain information
 Score =  489 bits (1260), Expect = e-175
 Identities = 214/324 (66%), Positives = 266/324 (82%), Gaps = 4/324 (1%)

Query: 1   MLQNLETNAAAGARPNNCWVESIRASSPTHMKSITPSL--LEEKRAWIIRHPSALDMFHE 58
           +L+N++     G R N  WV+S+RASSPTH+KS+  S+   ++  +WI++HPSAL+MF +
Sbjct: 44  LLKNIDIINGGGQRINA-WVDSMRASSPTHLKSLPSSISSQQQLNSWIMQHPSALEMFEQ 102

Query: 59  ITEASKGKQIVMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQLAKYFPTAIVTGRCRDKV 118
           I EAS+GKQIVMFLDYDGTLSPIV++PD+AFMS KMRR V++LAK FPTAIVTGRC DKV
Sbjct: 103 IMEASRGKQIVMFLDYDGTLSPIVDDPDKAFMSSKMRRTVKKLAKCFPTAIVTGRCIDKV 162

Query: 119 YDFVKLAELYYAGSHGMDIKGPTKGL-KYNQKSKVVNFQPASEFLPLIDKVYKVLVEKTK 177
           Y+FVKLAELYYAGSHGMDIKGP KG  ++ +  + + +QPA+++LP+ID+VY+ L+EKTK
Sbjct: 163 YNFVKLAELYYAGSHGMDIKGPAKGFSRHKRVKQSLLYQPANDYLPMIDEVYRQLLEKTK 222

Query: 178 STPGARVENNKFCISVHFRCVDEKKWNDLAQKVKEVVNEYPQLNWRQGRMVMEIRPKIEW 237
           STPGA+VEN+KFC SVHFRCVDEKKW++L  +V+ V+  +P L   QGR V EIRP IEW
Sbjct: 223 STPGAKVENHKFCASVHFRCVDEKKWSELVLQVRSVLKNFPTLKLTQGRKVFEIRPMIEW 282

Query: 238 DKGKALEFLLECLGFADCSNVFPVYIGDDTTDEDAFKILRKREQGFGILVSKFPKKTSAS 297
           DKGKALEFLLE LGF + +NVFPVYIGDD TDEDAFK+LR R +GFGILVSKFPK T AS
Sbjct: 283 DKGKALEFLLESLGFGNTNNVFPVYIGDDRTDEDAFKMLRDRGEGFGILVSKFPKDTDAS 342

Query: 298 YSLREPDEVMDFLQKLVRWKRDSA 321
           YSL++P EVMDFL +LV WK+   
Sbjct: 343 YSLQDPSEVMDFLARLVEWKQMQQ 366


Length = 366

>gnl|CDD|177812 PLN02151, PLN02151, trehalose-phosphatase Back     alignment and domain information
>gnl|CDD|215317 PLN02580, PLN02580, trehalose-phosphatase Back     alignment and domain information
>gnl|CDD|216992 pfam02358, Trehalose_PPase, Trehalose-phosphatase Back     alignment and domain information
>gnl|CDD|224789 COG1877, OtsB, Trehalose-6-phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|233092 TIGR00685, T6PP, trehalose-phosphatase Back     alignment and domain information
>gnl|CDD|184712 PRK14501, PRK14501, putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>gnl|CDD|182291 PRK10187, PRK10187, trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|233434 TIGR01484, HAD-SF-IIB, HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>gnl|CDD|177855 PLN02205, PLN02205, alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>gnl|CDD|233433 TIGR01482, SPP-subfamily, sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>gnl|CDD|223635 COG0561, Cof, Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|234910 PRK01158, PRK01158, phosphoglycolate phosphatase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 328
PLN03017366 trehalose-phosphatase 100.0
PLN02151354 trehalose-phosphatase 100.0
PLN02580384 trehalose-phosphatase 100.0
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 100.0
PF02358235 Trehalose_PPase: Trehalose-phosphatase; InterPro: 100.0
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 100.0
COG1877266 OtsB Trehalose-6-phosphatase [Carbohydrate transpo 100.0
PLN02205854 alpha,alpha-trehalose-phosphate synthase [UDP-form 100.0
PLN03063797 alpha,alpha-trehalose-phosphate synthase (UDP-form 100.0
PRK14501726 putative bifunctional trehalose-6-phosphate syntha 100.0
PLN03064934 alpha,alpha-trehalose-phosphate synthase (UDP-form 100.0
PRK10513270 sugar phosphate phosphatase; Provisional 99.97
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 99.97
PRK10976266 putative hydrolase; Provisional 99.97
PRK15126272 thiamin pyrimidine pyrophosphate hydrolase; Provis 99.97
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 99.97
PRK01158230 phosphoglycolate phosphatase; Provisional 99.97
PLN02887580 hydrolase family protein 99.96
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 99.96
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 99.96
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 99.96
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 99.95
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 99.95
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 99.95
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 99.95
TIGR02471236 sucr_syn_bact_C sucrose phosphate synthase, sucros 99.95
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 99.95
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 99.94
KOG1050732 consensus Trehalose-6-phosphate synthase component 99.93
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 99.93
PLN02382 413 probable sucrose-phosphatase 99.92
PTZ00174247 phosphomannomutase; Provisional 99.92
PLN02423245 phosphomannomutase 99.92
PRK14502694 bifunctional mannosyl-3-phosphoglycerate synthase/ 99.89
PF05116247 S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter 99.89
PRK12702302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 99.87
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 99.87
KOG1050 732 consensus Trehalose-6-phosphate synthase component 99.79
COG3769274 Predicted hydrolase (HAD superfamily) [General fun 99.68
KOG3189252 consensus Phosphomannomutase [Lipid transport and 99.5
PF03332220 PMM: Eukaryotic phosphomannomutase; InterPro: IPR0 99.35
TIGR024681050 sucrsPsyn_pln sucrose phosphate synthase/possible 99.32
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 99.25
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 99.16
PRK11133322 serB phosphoserine phosphatase; Provisional 99.03
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 98.94
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 98.69
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 98.47
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 98.4
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 98.36
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 98.31
TIGR01684301 viral_ppase viral phosphatase. These proteins also 98.24
PHA03398303 viral phosphatase superfamily protein; Provisional 97.96
PRK06769173 hypothetical protein; Validated 97.87
PRK10671834 copA copper exporting ATPase; Provisional 97.73
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 97.62
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 97.51
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 97.51
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 97.44
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 97.44
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 97.41
TIGR01497675 kdpB K+-transporting ATPase, B subunit. One sequen 97.4
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 97.37
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 97.31
PRK10444248 UMP phosphatase; Provisional 97.28
PF06437408 ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR0 97.25
PLN02645311 phosphoglycolate phosphatase 97.21
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 97.12
PRK11033741 zntA zinc/cadmium/mercury/lead-transporting ATPase 97.1
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 97.1
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 96.92
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 96.84
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 96.82
PRK13222226 phosphoglycolate phosphatase; Provisional 96.76
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 96.68
COG4030315 Uncharacterized protein conserved in archaea [Func 96.65
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 96.63
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 96.59
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 96.58
TIGR01522 884 ATPase-IIA2_Ca golgi membrane calcium-translocatin 96.57
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 96.42
PRK13582205 thrH phosphoserine phosphatase; Provisional 96.41
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 96.41
PHA02530300 pseT polynucleotide kinase; Provisional 96.38
TIGR01116 917 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium 96.32
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 96.31
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 96.29
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 96.28
PLN02954224 phosphoserine phosphatase 96.26
TIGR01657 1054 P-ATPase-V P-type ATPase of unknown pump specifici 96.2
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 96.16
TIGR01652 1057 ATPase-Plipid phospholipid-translocating P-type AT 96.12
PRK13225273 phosphoglycolate phosphatase; Provisional 96.11
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 96.07
PRK13288214 pyrophosphatase PpaX; Provisional 96.05
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 96.03
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 96.02
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 95.99
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 95.99
PRK13223272 phosphoglycolate phosphatase; Provisional 95.98
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 95.94
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 95.93
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 95.84
PF08235157 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 95.82
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 95.8
COG4087152 Soluble P-type ATPase [General function prediction 95.78
PRK13226229 phosphoglycolate phosphatase; Provisional 95.78
PLN03190 1178 aminophospholipid translocase; Provisional 95.65
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 95.62
PRK05446354 imidazole glycerol-phosphate dehydratase/histidino 95.62
COG2217713 ZntA Cation transport ATPase [Inorganic ion transp 95.54
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 95.51
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 95.49
TIGR01675229 plant-AP plant acid phosphatase. This model explic 95.48
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 95.38
COG0546220 Gph Predicted phosphatases [General function predi 95.37
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 95.26
PF1324275 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY 95.22
PRK13582205 thrH phosphoserine phosphatase; Provisional 95.1
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 95.06
PRK01122 679 potassium-transporting ATPase subunit B; Provision 95.05
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 95.02
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 94.89
PTZ00445219 p36-lilke protein; Provisional 94.87
TIGR01523 1053 ATPase-IID_K-Na potassium and/or sodium efflux P-t 94.87
TIGR01524 867 ATPase-IIIB_Mg magnesium-translocating P-type ATPa 94.83
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 94.8
PRK14010673 potassium-transporting ATPase subunit B; Provision 94.77
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 94.74
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 94.59
TIGR02245195 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase 94.56
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 94.55
PLN02954224 phosphoserine phosphatase 94.5
PRK08238 479 hypothetical protein; Validated 94.46
TIGR01686320 FkbH FkbH-like domain. The C-terminal portion of t 94.4
TIGR01106 997 ATPase-IIC_X-K sodium or proton efflux -- potassiu 94.35
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 94.33
TIGR01517 941 ATPase-IIB_Ca plasma-membrane calcium-translocatin 94.32
TIGR01647 755 ATPase-IIIA_H plasma-membrane proton-efflux P-type 94.22
PRK15122 903 magnesium-transporting ATPase; Provisional 94.21
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 94.19
PRK10517 902 magnesium-transporting ATPase MgtA; Provisional 94.18
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 94.17
PF03767229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 94.14
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 94.09
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 93.97
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 93.93
TIGR01456321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 93.59
COG0647269 NagD Predicted sugar phosphatases of the HAD super 93.56
TIGR01494499 ATPase_P-type ATPase, P-type (transporting), HAD s 93.54
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 93.48
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 93.37
KOG0210 1051 consensus P-type ATPase [Inorganic ion transport a 93.37
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 93.32
COG4359220 Uncharacterized conserved protein [Function unknow 93.26
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 93.22
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 93.14
TIGR01680275 Veg_Stor_Prot vegetative storage protein. The prot 92.73
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 92.65
PLN02575381 haloacid dehalogenase-like hydrolase 92.49
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 92.45
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 92.44
PRK11587218 putative phosphatase; Provisional 92.31
COG0474 917 MgtA Cation transport ATPase [Inorganic ion transp 92.25
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 92.12
PRK14988224 GMP/IMP nucleotidase; Provisional 92.11
PRK11590211 hypothetical protein; Provisional 92.01
COG0241181 HisB Histidinol phosphatase and related phosphatas 91.79
PRK09449224 dUMP phosphatase; Provisional 91.38
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 91.1
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 91.01
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 90.49
PLN02770248 haloacid dehalogenase-like hydrolase family protei 90.34
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 90.32
PLN02779286 haloacid dehalogenase-like hydrolase family protei 90.21
KOG1615227 consensus Phosphoserine phosphatase [Amino acid tr 89.9
KOG0202 972 consensus Ca2+ transporting ATPase [Inorganic ion 89.35
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 89.25
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 89.19
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 89.13
PRK11590211 hypothetical protein; Provisional 88.92
PRK13288214 pyrophosphatase PpaX; Provisional 88.86
PRK11587218 putative phosphatase; Provisional 88.53
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 88.5
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 88.47
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 88.43
PRK10748238 flavin mononucleotide phosphatase; Provisional 87.71
PLN02645311 phosphoglycolate phosphatase 87.62
PLN02770248 haloacid dehalogenase-like hydrolase family protei 87.47
COG2503274 Predicted secreted acid phosphatase [General funct 87.3
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 87.18
KOG0207951 consensus Cation transport ATPase [Inorganic ion t 87.15
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 86.9
COG3700237 AphA Acid phosphatase (class B) [General function 86.83
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 86.08
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 84.5
PHA02597197 30.2 hypothetical protein; Provisional 84.45
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 84.43
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 84.36
PRK13226229 phosphoglycolate phosphatase; Provisional 83.99
PLN02779286 haloacid dehalogenase-like hydrolase family protei 83.87
PRK10563221 6-phosphogluconate phosphatase; Provisional 83.82
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 83.79
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 83.66
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 83.42
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 83.21
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 83.14
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 83.12
KOG1615227 consensus Phosphoserine phosphatase [Amino acid tr 82.99
PLN02940 382 riboflavin kinase 82.87
COG0546220 Gph Predicted phosphatases [General function predi 82.74
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 82.63
PRK14988224 GMP/IMP nucleotidase; Provisional 82.55
PRK13225273 phosphoglycolate phosphatase; Provisional 82.49
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 82.37
PRK10444248 UMP phosphatase; Provisional 82.17
PRK13223272 phosphoglycolate phosphatase; Provisional 82.01
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 81.94
KOG3120256 consensus Predicted haloacid dehalogenase-like hyd 81.86
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 81.8
COG4087152 Soluble P-type ATPase [General function prediction 81.7
PRK10563221 6-phosphogluconate phosphatase; Provisional 81.54
PF05152297 DUF705: Protein of unknown function (DUF705); Inte 81.46
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 80.14
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 80.12
>PLN03017 trehalose-phosphatase Back     alignment and domain information
Probab=100.00  E-value=4.1e-69  Score=507.76  Aligned_cols=310  Identities=68%  Similarity=1.174  Sum_probs=280.7

Q ss_pred             CCCCCcchhHHHHHhcCCCCCCCCCc--cchHHHHHhhhhCCCCcchHHHHHHhhcCCCEEEEEecCCcccCCCCCCCcc
Q 020273           11 AGARPNNCWVESIRASSPTHMKSITP--SLLEEKRAWIIRHPSALDMFHEITEASKGKQIVMFLDYDGTLSPIVENPDRA   88 (328)
Q Consensus        11 ~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~w~~~~~~al~~~~~~~~~~~~k~~li~~D~DGTL~~~~~~p~~~   88 (328)
                      .|.+++++|+|+||+|||||+|+.++  +.+..|++|+.+|||||+.|++|+..+++++++||+||||||+|++++|+.+
T Consensus        53 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~psal~~~~~~~~~~~~k~~llflD~DGTL~Piv~~p~~a  132 (366)
T PLN03017         53 GGGQRINAWVDSMRASSPTHLKSLPSSISSQQQLNSWIMQHPSALEMFEQIMEASRGKQIVMFLDYDGTLSPIVDDPDKA  132 (366)
T ss_pred             ccccccchHHHHHhccCCCccccccccccchhhhhHHHhhCChHHHHHHHHHHHhcCCCeEEEEecCCcCcCCcCCcccc
Confidence            45788999999999999999886654  3467899999999999999999999999999999999999999999989888


Q ss_pred             cCChHHHHHHHHHHhcCCEEEEcCCChhhHHhhhCcccceEecCCCceeeCCCCCc-cccccCceeccCCCcccchHHHH
Q 020273           89 FMSGKMRRAVRQLAKYFPTAIVTGRCRDKVYDFVKLAELYYAGSHGMDIKGPTKGL-KYNQKSKVVNFQPASEFLPLIDK  167 (328)
Q Consensus        89 ~is~~~~~aL~~L~~~~~v~I~SGR~~~~v~~~~~~~~~~~i~~nG~~i~~~~~~~-~~~~~~e~~~~~~~~~~~~~i~e  167 (328)
                      .|+++++++|++|++.++|+|+|||++..+.+++++.+++|+|+||++++.|.+.. .+.+..+++.++++.+|++++++
T Consensus       133 ~i~~~~~~aL~~La~~~~vaIvSGR~~~~l~~~~~l~~l~l~g~hGa~i~~p~~~~~~~~~~~~~~~~~~~~~~~~~i~~  212 (366)
T PLN03017        133 FMSSKMRRTVKKLAKCFPTAIVTGRCIDKVYNFVKLAELYYAGSHGMDIKGPAKGFSRHKRVKQSLLYQPANDYLPMIDE  212 (366)
T ss_pred             cCCHHHHHHHHHHhcCCcEEEEeCCCHHHHHHhhcccCceEEEcCCcEEecCCCcceeccccccccccccchhhHHHHHH
Confidence            99999999999999668999999999999999988888999999999999876531 12233345567777789999999


Q ss_pred             HHHHHHHHhhcCCCcEEEecCcEEEEEcCCCChhhHHHHHHHHHHHHhhCCCeEEEecCeEEEEEcCCCCCHHHHHHHHH
Q 020273          168 VYKVLVEKTKSTPGARVENNKFCISVHFRCVDEKKWNDLAQKVKEVVNEYPQLNWRQGRMVMEIRPKIEWDKGKALEFLL  247 (328)
Q Consensus       168 v~~~l~~~~~~~~g~~ie~~~~~~~~~~r~~~~~~~~~~~~~v~~~l~~~~~l~~~~g~~~lEI~p~~~~~KG~al~~Ll  247 (328)
                      +.+.|.++++.+||+++|+|++|++||||++++..|.++...+..+++.+|+++++.|++++||+|.++||||.|+++|+
T Consensus       213 v~~~L~~~~~~~pGa~VE~K~~~vavHyR~ad~~~~~~l~~~~~~vl~~~~~l~v~~GkkVlEvRP~~~~dKG~Av~~LL  292 (366)
T PLN03017        213 VYRQLLEKTKSTPGAKVENHKFCASVHFRCVDEKKWSELVLQVRSVLKNFPTLKLTQGRKVFEIRPMIEWDKGKALEFLL  292 (366)
T ss_pred             HHHHHHHHHhcCCCCEEEecCcEEEEEcCcCCHHHHHHHHHHHHHHHHhCCCcEEeCCCeEEEecCCCCCCHHHHHHHHH
Confidence            99999999999999999999999999999999888888888899999999999999999999999966999999999999


Q ss_pred             HHcCCCCCCCceEEEEeCCcCCHHHHHHHHhCCCceEEEEcCCCCCccceEEeCChhHHHHHHHHHHHhhhcC
Q 020273          248 ECLGFADCSNVFPVYIGDDTTDEDAFKILRKREQGFGILVSKFPKKTSASYSLREPDEVMDFLQKLVRWKRDS  320 (328)
Q Consensus       248 ~~lg~~~~~~~~~i~~GD~~nD~~Mf~~~~~~~~g~~v~v~n~~~~t~A~~~l~~~~~V~~~L~~l~~~~~~~  320 (328)
                      +.+|+...++++++|||||.|||+||+++++.++|+||.||..+++|.|+|++++|++|.+||++|+.|++.+
T Consensus       293 ~~l~~~~~~~~~pvyiGDD~TDEDaF~~L~~~~~G~gI~VG~~~k~T~A~y~L~dp~eV~~fL~~L~~~~~~~  365 (366)
T PLN03017        293 ESLGFGNTNNVFPVYIGDDRTDEDAFKMLRDRGEGFGILVSKFPKDTDASYSLQDPSEVMDFLARLVEWKQMQ  365 (366)
T ss_pred             HhcccccCCCceEEEeCCCCccHHHHHHHhhcCCceEEEECCCCCCCcceEeCCCHHHHHHHHHHHHHHHhhc
Confidence            9999887666799999999999999999987767999999988888999999999999999999999999864



>PLN02151 trehalose-phosphatase Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3 Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>KOG1050 consensus Trehalose-6-phosphate synthase component TPS1 and related subunits [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>PLN02382 probable sucrose-phosphatase Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>KOG1050 consensus Trehalose-6-phosphate synthase component TPS1 and related subunits [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>KOG3189 consensus Phosphomannomutase [Lipid transport and metabolism] Back     alignment and domain information
>PF03332 PMM: Eukaryotic phosphomannomutase; InterPro: IPR005002 This enzyme (5 Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>TIGR01497 kdpB K+-transporting ATPase, B subunit Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>PF06437 ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR009453 The Saccharomyces cerevisiae ISN1 (YOR155c) gene encodes an IMP-specific 5'-nucleotidase, which catalyses degradation of IMP to inosine as part of the purine salvage pathway Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>COG4030 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PLN03190 aminophospholipid translocase; Provisional Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>PRK01122 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>PTZ00445 p36-lilke protein; Provisional Back     alignment and domain information
>TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type Back     alignment and domain information
>TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>PRK14010 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase Back     alignment and domain information
>TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase Back     alignment and domain information
>PRK15122 magnesium-transporting ATPase; Provisional Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>PRK10517 magnesium-transporting ATPase MgtA; Provisional Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>KOG0210 consensus P-type ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>TIGR01680 Veg_Stor_Prot vegetative storage protein Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>COG3700 AphA Acid phosphatase (class B) [General function prediction only] Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query328
1u02_A239 Crystal Structure Of Trehalose-6-Phosphate Phosphat 3e-11
>pdb|1U02|A Chain A, Crystal Structure Of Trehalose-6-Phosphate Phosphatase Related Protein Length = 239 Back     alignment and structure

Iteration: 1

Score = 65.5 bits (158), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 53/208 (25%), Positives = 91/208 (43%), Gaps = 24/208 (11%) Query: 69 VMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQLAKYFPTAIVTGRCRDKVYDFVKLAELY 128 ++FLDYDGTL PI+ NP+ ++ + + L + F T IVTGR +++ F+ L ++ Sbjct: 3 LIFLDYDGTLVPIIXNPEESYADAGLLSLISDLKERFDTYIVTGRSPEEISRFLPL-DIN 61 Query: 129 YAGSHGMDIKGPTKGLKYNQKSKVVNFQPASEFLPLIDKVYKVLVEKTKSTPGARVENNK 188 HG K ++V + FL + D++Y+ PG R+ Sbjct: 62 XICYHGACSK---------INGQIVYNNGSDRFLGVFDRIYEDTRSWVSDFPGLRIYRKN 112 Query: 189 FCISVHFRCVDEKKWNDLAQKVKEVVNEYPQLNWRQGRMVMEIR-PKIEWDKGKALEFLL 247 + H L +++E+ + + G+ ++E+R P + +KG A+ Sbjct: 113 LAVLYHLGLXGADXKPKLRSRIEEIARIFGVETY-YGKXIIELRVPGV--NKGSAIR--- 166 Query: 248 ECLGFADCSNVFPVYI-GDDTTDEDAFK 274 P I GDD TDE AF+ Sbjct: 167 ------SVRGERPAIIAGDDATDEAAFE 188

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query328
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 2e-87
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 8e-10
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 7e-09
1y8a_A332 Hypothetical protein AF1437; structural genomics, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 3e-07
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 1e-06
1l6r_A227 Hypothetical protein TA0175; structural genomics, 8e-05
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 5e-04
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Length = 239 Back     alignment and structure
 Score =  261 bits (669), Expect = 2e-87
 Identities = 57/247 (23%), Positives = 104/247 (42%), Gaps = 25/247 (10%)

Query: 69  VMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQLAKYFPTAIVTGRCRDKVYDFVKLAELY 128
           ++FLDYDGTL PI+ NP+ ++    +   +  L + F T IVTGR  +++  F+ L ++ 
Sbjct: 3   LIFLDYDGTLVPIIMNPEESYADAGLLSLISDLKERFDTYIVTGRSPEEISRFLPL-DIN 61

Query: 129 YAGSHGMDIKGPTKGLKYNQKSKVVNFQPASEFLPLIDKVYKVLVEKTKSTPGARVENNK 188
               HG   K            ++V    +  FL + D++Y+         PG R+    
Sbjct: 62  MICYHGACSKIN---------GQIVYNNGSDRFLGVFDRIYEDTRSWVSDFPGLRIYRKN 112

Query: 189 FCISVHFRCVDEKKWNDLAQKVKEVVNEYPQLNWRQGRMVMEIRPKIEWDKGKALEFLLE 248
             +  H   +       L  +++E+   +  +    G+M++E+R     +KG A+  +  
Sbjct: 113 LAVLYHLGLMGADMKPKLRSRIEEIARIFG-VETYYGKMIIELRV-PGVNKGSAIRSVRG 170

Query: 249 CLGFADCSNVFPVYIGDDTTDEDAFKILRKREQGFGILVSKFPKKTSASYSLREPDEVMD 308
                       +  GDD TDE AF+          I V     +T A + + +  E+  
Sbjct: 171 E--------RPAIIAGDDATDEAAFEANDD---ALTIKVG--EGETHAKFHVADYIEMRK 217

Query: 309 FLQKLVR 315
            L+ +  
Sbjct: 218 ILKFIEM 224


>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Length = 246 Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Length = 262 Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Length = 332 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} PDB: 2i54_A* 2i55_A* Length = 246 Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Length = 275 Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Length = 227 Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Length = 289 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query328
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 100.0
3dao_A283 Putative phosphatse; structural genomics, joint ce 99.97
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 99.97
3dnp_A290 Stress response protein YHAX; structural PSI-2, pr 99.96
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 99.96
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 99.96
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 99.96
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 99.95
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 99.95
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 99.95
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 99.95
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 99.95
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 99.95
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 99.95
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 99.95
1l6r_A227 Hypothetical protein TA0175; structural genomics, 99.95
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 99.94
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 99.94
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 99.94
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 99.94
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 99.94
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 99.93
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 99.93
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 99.93
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 99.92
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 99.89
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 99.56
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 99.56
1y8a_A332 Hypothetical protein AF1437; structural genomics, 99.56
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 99.5
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 99.49
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 99.44
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 99.41
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 99.41
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 99.4
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 99.39
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 99.38
3mmz_A176 Putative HAD family hydrolase; structural genomics 99.35
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 99.33
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.33
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 99.3
3mn1_A189 Probable YRBI family phosphatase; structural genom 99.27
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.19
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; 99.16
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 99.13
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 99.1
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 99.1
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 99.09
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 99.04
1te2_A226 Putative phosphatase; structural genomics, phospha 99.02
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 99.02
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 99.0
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 98.98
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 98.96
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 98.9
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 98.9
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 98.88
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 98.87
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 98.87
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 98.83
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 98.8
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 98.75
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 98.72
3j09_A723 COPA, copper-exporting P-type ATPase A; copper tra 98.71
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 98.7
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 98.66
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 98.66
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 98.65
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 98.64
2o2x_A218 Hypothetical protein; structural genomics, joint c 98.64
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 98.61
3fvv_A232 Uncharacterized protein; unknown function, structu 98.53
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 98.46
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 98.43
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 98.42
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 98.41
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 98.4
3ixz_A 1034 Potassium-transporting ATPase alpha; ION pump, H+, 98.4
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 98.39
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 98.38
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 98.36
3ib6_A189 Uncharacterized protein; structural genomics, unkn 98.31
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 98.31
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 98.29
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 98.28
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 98.27
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 98.23
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 98.22
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 98.17
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 98.16
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 98.15
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 98.12
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 98.07
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 98.05
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 98.05
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 98.04
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 97.97
3sd7_A240 Putative phosphatase; structural genomics, haloaci 97.95
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 97.95
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 97.94
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 97.93
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 97.9
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 97.87
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 97.81
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 97.75
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 97.64
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 97.61
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 97.6
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 97.59
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 97.58
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 97.58
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 97.57
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 97.54
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 97.5
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 97.47
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 97.41
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 97.29
3ar4_A 995 Sarcoplasmic/endoplasmic reticulum calcium ATPase; 97.25
2hsz_A243 Novel predicted phosphatase; structural genomics, 97.23
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 97.13
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 97.07
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 97.07
1mhs_A 920 Proton pump, plasma membrane ATPase; ION transport 97.01
2zxe_A 1028 Na, K-ATPase alpha subunit; membrane protein, ION 97.0
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 96.94
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 96.86
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 96.85
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 96.84
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 96.76
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 96.73
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 95.75
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 96.69
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 96.68
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 96.62
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 96.53
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 96.52
3b8c_A 885 ATPase 2, plasma membrane-type; P-type ATPase, pro 96.39
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 96.16
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 96.02
3kc2_A352 Uncharacterized protein YKR070W; HAD-like, mitocho 96.01
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 96.0
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 95.98
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 95.73
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 95.65
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 95.49
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 95.29
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 95.27
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 95.26
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 95.01
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 94.87
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 94.83
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 94.73
4as2_A327 Phosphorylcholine phosphatase; hydrolase, HAD supe 94.57
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 94.28
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 94.27
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 94.18
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 94.17
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 94.14
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 94.02
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 93.95
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 93.59
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 93.56
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 93.54
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 93.53
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 93.26
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 93.13
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 93.04
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 92.95
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 92.94
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 92.9
2p11_A231 Hypothetical protein; putative haloacid dehalogena 92.85
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 92.83
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 92.8
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 92.77
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 92.57
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 92.48
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 92.34
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 92.17
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 92.13
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 92.11
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 92.02
4gxt_A385 A conserved functionally unknown protein; structur 92.02
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 91.73
3sd7_A240 Putative phosphatase; structural genomics, haloaci 91.62
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 91.62
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 91.57
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 91.45
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 91.36
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 91.33
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 91.13
3ef0_A372 RNA polymerase II subunit A C-terminal domain phos 90.5
2p11_A231 Hypothetical protein; putative haloacid dehalogena 90.49
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 90.23
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 89.98
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 89.71
2hsz_A243 Novel predicted phosphatase; structural genomics, 89.44
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 89.34
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 89.07
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 88.97
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 88.59
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 88.52
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 88.46
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 88.07
2zg6_A220 Putative uncharacterized protein ST2620, probable 87.98
2zg6_A220 Putative uncharacterized protein ST2620, probable 87.9
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 87.51
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 86.91
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 86.5
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 85.39
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 84.79
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 84.76
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 83.6
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 83.26
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 82.8
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 82.54
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 81.39
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 80.24
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
Probab=100.00  E-value=4.4e-35  Score=264.21  Aligned_cols=227  Identities=25%  Similarity=0.395  Sum_probs=168.0

Q ss_pred             EEEEEecCCcccCCCCCCCcccCChHHHHHHHHHHhcCCEEEEcCCChhhHHhhhCcccceEecCCCceeeCCCCCcccc
Q 020273           68 IVMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQLAKYFPTAIVTGRCRDKVYDFVKLAELYYAGSHGMDIKGPTKGLKYN  147 (328)
Q Consensus        68 ~li~~D~DGTL~~~~~~p~~~~is~~~~~aL~~L~~~~~v~I~SGR~~~~v~~~~~~~~~~~i~~nG~~i~~~~~~~~~~  147 (328)
                      ++||+||||||++...+|+...++++++++|++|+++++|+|+|||++..+.+++... .++|++||+.|+. .+...+.
T Consensus         2 kli~~DlDGTLl~~~~~~~~~~i~~~~~~al~~l~~~g~v~iaTGR~~~~~~~~~~~l-~~~I~~nGa~i~~-~~~~~~~   79 (239)
T 1u02_A            2 SLIFLDYDGTLVPIIMNPEESYADAGLLSLISDLKERFDTYIVTGRSPEEISRFLPLD-INMICYHGACSKI-NGQIVYN   79 (239)
T ss_dssp             CEEEEECBTTTBCCCSCGGGCCCCHHHHHHHHHHHHHSEEEEECSSCHHHHHHHSCSS-CEEEEGGGTEEEE-TTEEEEC
T ss_pred             eEEEEecCCCCcCCCCCcccCCCCHHHHHHHHHHhcCCCEEEEeCCCHHHHHHHhccc-hheEEECCEEEee-CCeeeec
Confidence            5899999999999765555678999999999999987799999999999999988654 7899999999987 3321100


Q ss_pred             ccCceeccCCCcccchHHHHHHHHHHHHhhcCCCcEEEecCcEEEEEcCCCChhhHHHHHHHHHHHHhhCCCeEEEecCe
Q 020273          148 QKSKVVNFQPASEFLPLIDKVYKVLVEKTKSTPGARVENNKFCISVHFRCVDEKKWNDLAQKVKEVVNEYPQLNWRQGRM  227 (328)
Q Consensus       148 ~~~e~~~~~~~~~~~~~i~ev~~~l~~~~~~~~g~~ie~~~~~~~~~~r~~~~~~~~~~~~~v~~~l~~~~~l~~~~g~~  227 (328)
                      .  . .++.     .++-.+..+.+..+....++.+++.+...+.++|+.+++.. ..+.+.+.+.++..+++.+.++..
T Consensus        80 ~--~-~~~~-----~~l~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~l~~~~~~~~~~~~~  150 (239)
T 1u02_A           80 N--G-SDRF-----LGVFDRIYEDTRSWVSDFPGLRIYRKNLAVLYHLGLMGADM-KPKLRSRIEEIARIFGVETYYGKM  150 (239)
T ss_dssp             T--T-GGGG-----HHHHHHHHHHHTTHHHHSTTCEEEEETTEEEEECTTSCSTT-HHHHHHHHHHHHHHHTCEEEECSS
T ss_pred             c--c-cccc-----chhhHHHHHHHHHHHhhCCCcEEEecCCEEEEEcCCCChhH-HHHHHHHHHHHhccCCcEEEeCCc
Confidence            0  0 0111     01112222222233334467788877777888888765321 122233333333324567778889


Q ss_pred             EEEEEcCCCCCHHHHHHHHHHHcCCCCCCCceEEEEeCCcCCHHHHHHHHhCCCceEEEEcCCCCCccceEEeCC---hh
Q 020273          228 VMEIRPKIEWDKGKALEFLLECLGFADCSNVFPVYIGDDTTDEDAFKILRKREQGFGILVSKFPKKTSASYSLRE---PD  304 (328)
Q Consensus       228 ~lEI~p~~~~~KG~al~~Ll~~lg~~~~~~~~~i~~GD~~nD~~Mf~~~~~~~~g~~v~v~n~~~~t~A~~~l~~---~~  304 (328)
                      ++||+|+ ++|||.||++|++.+|        +++|||+.||++||+.++.   |+||+|+|+  ++.|+|++.+   ++
T Consensus       151 ~lei~~~-~~~Kg~al~~l~~~~g--------via~GD~~ND~~Ml~~a~~---g~~vam~Na--~~~A~~v~~~~~~~~  216 (239)
T 1u02_A          151 IIELRVP-GVNKGSAIRSVRGERP--------AIIAGDDATDEAAFEANDD---ALTIKVGEG--ETHAKFHVADYIEMR  216 (239)
T ss_dssp             EEEEECT-TCCHHHHHHHHHTTSC--------EEEEESSHHHHHHHHTTTT---SEEEEESSS--CCCCSEEESSHHHHH
T ss_pred             EEEEEcC-CCCHHHHHHHHHhhCC--------eEEEeCCCccHHHHHHhhC---CcEEEECCC--CCcceEEeCCCCCHH
Confidence            9999999 9999999999999987        8999999999999998743   899999998  5789999988   88


Q ss_pred             HHHHHHHHHHHhhhc
Q 020273          305 EVMDFLQKLVRWKRD  319 (328)
Q Consensus       305 ~V~~~L~~l~~~~~~  319 (328)
                      +|+++|++++....+
T Consensus       217 gV~~~l~~~~~~~~~  231 (239)
T 1u02_A          217 KILKFIEMLGVQKKQ  231 (239)
T ss_dssp             HHHHHHHHHHHHHC-
T ss_pred             HHHHHHHHHHHhccc
Confidence            999999999866543



>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Back     alignment and structure
>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 328
d1u02a_229 c.108.1.15 (A:) Trehalose-6-phosphate phosphatase 1e-36
d2amya1243 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human ( 9e-12
d1s2oa1244 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 { 1e-07
d2fuea1244 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human 3e-07
d1xvia_232 c.108.1.10 (A:) Putative mannosyl-3-phosphoglycera 1e-06
d2rbka1260 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase B 5e-06
d1l6ra_225 c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa 2e-04
d1wzca1243 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphogl 3e-04
d1nf2a_267 c.108.1.10 (A:) Hypothetical protein TM0651 {Therm 4e-04
d1wr8a_230 c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa 0.001
d2b30a1283 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmod 0.001
d1rlma_269 c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Esc 0.002
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 229 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Trehalose-phosphatase
domain: Trehalose-6-phosphate phosphatase related protein
species: Archaeon Thermoplasma acidophilum [TaxId: 2303]
 Score =  129 bits (325), Expect = 1e-36
 Identities = 58/252 (23%), Positives = 103/252 (40%), Gaps = 28/252 (11%)

Query: 70  MFLDYDGTLSPIVENPDRAFMSGKMRRAVRQLAKYFPTAIVTGRCRDKVYDFVKLAELYY 129
           +FLDYDGTL PI+ NP+ ++    +   +  L + F T IVTGR  +++  F+ L     
Sbjct: 3   IFLDYDGTLVPIIMNPEESYADAGLLSLISDLKERFDTYIVTGRSPEEISRFLPLDI-NM 61

Query: 130 AGSHGMDIKGPTKGLKYNQKSKVVNFQPASEFLPLIDKVYKVLVEKTKSTPGARVENNKF 189
              HG                ++V    +  FL + D++Y+         PG R+     
Sbjct: 62  ICYHGAC---------SKINGQIVYNNGSDRFLGVFDRIYEDTRSWVSDFPGLRIYRKNL 112

Query: 190 CISVHFRCVDEKKWNDLAQKVKEVVNEYPQLNWRQGRMVMEIRPKIEWDKGKALEFLLEC 249
            +  H   +       L  +++E+   +  +    G+M++E+R     +KG A+  +   
Sbjct: 113 AVLYHLGLMGADMKPKLRSRIEEIARIFG-VETYYGKMIIELRVP-GVNKGSAIRSVRGE 170

Query: 250 LGFADCSNVFPVYIGDDTTDEDAFKILRKREQGFGILVSKFPKKTSASYSLREPDEVMDF 309
                      +  GDD TDE AF+     +    I V     +T A + + +  E+   
Sbjct: 171 --------RPAIIAGDDATDEAAFEAN---DDALTIKVG--EGETHAKFHVADYIEMRKI 217

Query: 310 L---QKLVRWKR 318
           L   + L   K+
Sbjct: 218 LKFIEMLGVQKK 229


>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 244 Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 260 Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 225 Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 243 Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Length = 267 Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Length = 230 Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Length = 283 Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Length = 269 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query328
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 100.0
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 99.97
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 99.97
d1nrwa_285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 99.97
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 99.97
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 99.97
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 99.96
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 99.95
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 99.94
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 99.94
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 99.94
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 99.93
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 99.9
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 99.88
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 99.54
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 99.07
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 98.91
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 98.78
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 98.77
d1vjra_261 Hypothetical protein TM1742 {Thermotoga maritima [ 98.66
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 98.53
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 98.29
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 98.2
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 98.17
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 98.06
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 98.05
d1wpga2168 Calcium ATPase, catalytic domain P {Rabbit (Orycto 97.72
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 97.61
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 97.49
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 97.47
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 97.12
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 97.09
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 97.09
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 96.7
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 96.48
d1y8aa1308 Hypothetical protein AF1437 {Archaeon Archaeoglobu 96.34
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 95.89
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 95.82
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 95.48
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 95.29
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 95.27
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 95.02
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 95.0
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 94.85
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 94.46
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 94.35
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 94.32
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 94.19
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 94.15
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 93.92
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 93.48
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 93.35
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 93.18
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 92.91
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 92.9
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 92.69
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 92.56
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 92.48
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 92.21
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 90.57
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 88.86
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 88.6
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 88.15
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 87.67
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 87.3
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 86.89
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 84.65
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 84.23
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 81.17
d2g80a1225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 80.93
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 80.29
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Trehalose-phosphatase
domain: Trehalose-6-phosphate phosphatase related protein
species: Archaeon Thermoplasma acidophilum [TaxId: 2303]
Probab=100.00  E-value=5.2e-37  Score=268.48  Aligned_cols=223  Identities=26%  Similarity=0.415  Sum_probs=182.2

Q ss_pred             EEEEecCCcccCCCCCCCcccCChHHHHHHHHHHhcCCEEEEcCCChhhHHhhhCcccceEecCCCceeeCCCCCccccc
Q 020273           69 VMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQLAKYFPTAIVTGRCRDKVYDFVKLAELYYAGSHGMDIKGPTKGLKYNQ  148 (328)
Q Consensus        69 li~~D~DGTL~~~~~~p~~~~is~~~~~aL~~L~~~~~v~I~SGR~~~~v~~~~~~~~~~~i~~nG~~i~~~~~~~~~~~  148 (328)
                      |||||+||||+++..+|+...++++++++|++|++.++|+|+|||+...+..+... ..+++|+||+.+..++... +  
T Consensus         2 Li~~DlDGTL~~~~~~~~~~~i~~~~~~~l~~l~~~~~v~i~TGR~~~~l~~~~~~-~~~~~~~ng~~~~~~~~~~-~--   77 (229)
T d1u02a_           2 LIFLDYDGTLVPIIMNPEESYADAGLLSLISDLKERFDTYIVTGRSPEEISRFLPL-DINMICYHGACSKINGQIV-Y--   77 (229)
T ss_dssp             EEEEECBTTTBCCCSCGGGCCCCHHHHHHHHHHHHHSEEEEECSSCHHHHHHHSCS-SCEEEEGGGTEEEETTEEE-E--
T ss_pred             EEEEEecCCCCCCCCChhhCCCCHHHHHHHHHHhhCCCEEEEcCCCHHHhhhhcCc-cccEEecCeEEEecCCcee-e--
Confidence            79999999999988888888999999999999998888999999999999887754 3479999999988765421 1  


Q ss_pred             cCceeccCCCcccchHHHHHHHHHHHHhhcCCCcEEEecCcEEEEEcCCCChhhHHHHHHHHHHHHhhCCCeEEEecCeE
Q 020273          149 KSKVVNFQPASEFLPLIDKVYKVLVEKTKSTPGARVENNKFCISVHFRCVDEKKWNDLAQKVKEVVNEYPQLNWRQGRMV  228 (328)
Q Consensus       149 ~~e~~~~~~~~~~~~~i~ev~~~l~~~~~~~~g~~ie~~~~~~~~~~r~~~~~~~~~~~~~v~~~l~~~~~l~~~~g~~~  228 (328)
                            ..+......+++++.+.+.......++...+.+..+..+++............+.+.+.+..+ .+.+.+|..+
T Consensus        78 ------~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~-~~~~~~~~~~  150 (229)
T d1u02a_          78 ------NNGSDRFLGVFDRIYEDTRSWVSDFPGLRIYRKNLAVLYHLGLMGADMKPKLRSRIEEIARIF-GVETYYGKMI  150 (229)
T ss_dssp             ------CTTGGGGHHHHHHHHHHHTTHHHHSTTCEEEEETTEEEEECTTSCSTTHHHHHHHHHHHHHHH-TCEEEECSSE
T ss_pred             ------ecchhhhHHHHHHHHHHhHHhhcccCCceecccccceeeeehhhhhhhHHHHHHHHHHHhhcC-CeEEEeeceE
Confidence                  112222344567777777666777899999999999999998877666666667777777665 5678888999


Q ss_pred             EEEEcCCCCCHHHHHHHHHHHcCCCCCCCceEEEEeCCcCCHHHHHHHHhCCCceEEEEcCCCCCccceEEeCChhHHHH
Q 020273          229 MEIRPKIEWDKGKALEFLLECLGFADCSNVFPVYIGDDTTDEDAFKILRKREQGFGILVSKFPKKTSASYSLREPDEVMD  308 (328)
Q Consensus       229 lEI~p~~~~~KG~al~~Ll~~lg~~~~~~~~~i~~GD~~nD~~Mf~~~~~~~~g~~v~v~n~~~~t~A~~~l~~~~~V~~  308 (328)
                      +||.|+ |+|||.|+++|++.     +   ++++||||.||++||+++.   +|++|+||++  ++.|+|+++++++|.+
T Consensus       151 idi~p~-g~~Kg~al~~l~~~-----~---~~i~~GDs~ND~~Mf~~~~---~~~av~~g~~--~~~A~~~~~~~~ev~~  216 (229)
T d1u02a_         151 IELRVP-GVNKGSAIRSVRGE-----R---PAIIAGDDATDEAAFEAND---DALTIKVGEG--ETHAKFHVADYIEMRK  216 (229)
T ss_dssp             EEEECT-TCCHHHHHHHHHTT-----S---CEEEEESSHHHHHHHHTTT---TSEEEEESSS--CCCCSEEESSHHHHHH
T ss_pred             EEEecC-CCCHHHHHHHHhcc-----c---cceeecCCCChHHHHhccC---CeEEEEeCCC--CccCeEEcCCHHHHHH
Confidence            999999 99999999999864     2   6999999999999999984   3777777754  6899999999999999


Q ss_pred             HHHHHHHh
Q 020273          309 FLQKLVRW  316 (328)
Q Consensus       309 ~L~~l~~~  316 (328)
                      ||+.|-..
T Consensus       217 ~l~~l~~~  224 (229)
T d1u02a_         217 ILKFIEML  224 (229)
T ss_dssp             HHHHHHHH
T ss_pred             HHHHHHHH
Confidence            99887443



>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure