Citrus Sinensis ID: 020299

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33

MDQGSEMGSISIPDVPLKSSNRRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQTEQPLGDAIAEALSTGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSSKPGSYEFPIKKEDFLPMDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDILATAKIPPAANQVEMNPLWQQNKLREFCKAKDIQLAAYAPLGARGTIWGSNRVMECEVLKEIAEAKGKTVAQVCLRWAYEQGVCVVVKSFNKERMKENLDIFNWELTDEETKKISDIPQSRGCLGEDYISANGPIKTIEELWDGET

ccccccccccccccEEEcccccccccccCCccccccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccccccccEEEEccccccccccccHHHHHHHHHHHHccccccccEECcccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHcccEEEEEccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHcccEEEEccccHHHHHHHHccccccccHHHHHHHHccccccCEccccccccccccccccccccccc

************PDVPLKSSNRRMPVLGLGTAASPFSGSETTKLAILEAMKLGYRHFDTATLYQTEQPLGDAIAEALSTGIIKSRDELFIASKLWCSDAHRELVVPALQKSLENLQLEYIDLYVIHWPVSSKPGSYEFPIKKEDFLPMDFKSVWEAMEECQNLGYTKAIGVSNFSCKKLGDILATAKIPPAANQVEMNPLWQQNKLREFCKAKDIQLAAYAPLGARGTIWGSNRVMECEVLKEIAEAKGKTVAQVCLRWAYEQGVCVVVKSFNKERMKENLDIFNWELTDEETKKISDIPQSRGCLGEDYISANGPIKTIEELWDGET

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
NADPH-dependent codeinone reductase 1-3	Reduces codeinone to codeine in the penultimate step in morphine biosynthesis. Can use morphinone, hydrocodone and hydromorphone as substrate during reductive reaction with NADPH as cofactor, and morphine and dihydrocodeine as substrate during oxidative reaction with NADP as cofactor.	probable	Q9SQ68
NADPH-dependent codeinone reductase 1-2	Reduces codeinone to codeine in the penultimate step in morphine biosynthesis. Can use morphinone, hydrocodone and hydromorphone as substrate during reductive reaction with NADPH as cofactor, and morphine and dihydrocodeine as substrate during oxidative reaction with NADP as cofactor.	probable	Q9SQ69
Aldo-keto reductase family 1 member C21	NADP-dependent 17-alpha-hydroxysteroid dehydrogenase that converts 5-alpha-androstane-3,17-dione into epitestosterone. Has lower 3-alpha-hydroxysteroid dehydrogenase activity. Has broad substrate specificity and acts on various 17-alpha-hydroxysteroids, 17-ketosteroids, 3-alpha hydroxysteroids and 3-ketosteroids. Reduction of keto groups is strictly stereoselective. Reduction of 17-ketosteroids yields only 17-alpha-hydroxysteroids. Likewise, reduction of 3-ketosteroids yields only 3-alpha-hydroxysteroids.	probable	Q91WR5

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H7U, chain A
Confidence level:very confident
Coverage over the Query: 11-327
View the alignment between query and template
View the model in PyMOL